KEGG   Vibrio gazogenes: BSQ33_14035Help
Entry
BSQ33_14035       CDS       T04933                                 

Definition
(GenBank) NAD(P)H nitroreductase
Organism
vga  Vibrio gazogenes
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase
Motif
Other DBs
NCBI-ProteinID: ASA56700
UniProt: A0A1Z2SHN9
Position
1:3059203..3059751
Genome map
AA seq 182 aa AA seqDB search
MDALELLLNRRSVAKLGAPAPEGNVLENIIRAGLRAPDHGGLTPWRFVIAQEHGLKKLSD
ILVQAVIADQGDEAQLEKVKNAPFRAPMVITVIAKVTPHEKVPALEQHLSAGCAVQAMQM
AAQAQGFQGVWRSGKWMFHPLVHQAFGLAGDDEIVGFLYLGTPLLEPMKVPDRNLSRFVE
YL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggatgcattagagttactgctaaatcgccgttccgttgcgaaattaggcgcaccggcg
ccagaagggaatgtcttggaaaatattatccgggccgggcttcgggcccccgatcatggc
gggttaacgccttggcgttttgtgattgcccaagagcacggattaaaaaaattgtcggat
attttagtgcaagcggtgattgctgatcagggtgatgaggcgcagcttgaaaaagtcaaa
aatgcacctttccgagcaccaatggtgattactgtgatcgcgaaagtcacaccgcatgaa
aaagtcccggcattagagcaacatttgtcggccggatgtgccgtacaggcgatgcaaatg
gcagcgcaggcgcaggggtttcaaggggtgtggcgttccggtaaatggatgttccatccg
ttagtccatcaggcttttggtttggcaggtgatgatgagattgtcggttttctctattta
ggcacaccgttgcttgaaccgatgaaagtgcctgaccgaaatttatcccgttttgttgaa
tacttataa

DBGET integrated database retrieval system