KEGG   Vibrio gazogenes: BSQ33_16870Help
Entry
BSQ33_16870       CDS       T04933                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vga  Vibrio gazogenes
Pathway
vga00071  Fatty acid degradation
vga00280  Valine, leucine and isoleucine degradation
vga00310  Lysine degradation
vga00362  Benzoate degradation
vga00380  Tryptophan metabolism
vga00620  Pyruvate metabolism
vga00630  Glyoxylate and dicarboxylate metabolism
vga00640  Propanoate metabolism
vga00650  Butanoate metabolism
vga00900  Terpenoid backbone biosynthesis
vga01100  Metabolic pathways
vga01110  Biosynthesis of secondary metabolites
vga01120  Microbial metabolism in diverse environments
vga01130  Biosynthesis of antibiotics
vga01200  Carbon metabolism
vga01212  Fatty acid metabolism
vga02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSQ33_16870
   00630 Glyoxylate and dicarboxylate metabolism
    BSQ33_16870
   00640 Propanoate metabolism
    BSQ33_16870
   00650 Butanoate metabolism
    BSQ33_16870
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSQ33_16870
   00072 Synthesis and degradation of ketone bodies
    BSQ33_16870
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSQ33_16870
   00310 Lysine degradation
    BSQ33_16870
   00380 Tryptophan metabolism
    BSQ33_16870
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSQ33_16870
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSQ33_16870
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSQ33_16870
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vga04147]
    BSQ33_16870
Enzymes [BR:vga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSQ33_16870
Exosome [BR:vga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSQ33_16870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ASA57438
UniProt: A0A1Z2SJS8
Position
2:252845..254053
Genome map
AA seq 402 aa AA seqDB search
MEKIFIVAAKRTPVGSFGGSLKNVDAGHLGAAVIQGALSAASLSPDAVDEVIVGNVIGAG
QGMSIGRQASLFAGIPETTPAYNINMVCGSGMKSVMDGVSHILSGDAQVVVAAGVEVMSQ
IPYALPGSIRDGHKMGDMTLVDLLIRDGLTDIFNQYHMGCTAENIAGEYDISREAQDQFA
LSSQQKAVAAIKAGKFVDEIVPIEVKIKRDSVMFDTDEHPKADSSIERLARLRPAFMKEG
TVTAGNASGLNDGASAVIVASESAVKKFGLTPLVEIVSYAQAGVDPKVMGLGPVPAVTKA
LKRAGKTLDEMDLLELNEAFAAQALGVVKGLSREHAVSEEAILQKANVNGGAIALGHPLG
ASGNRILVTLIHELKRRGDQYGVASLCIGGGMGTAVIVKAVG
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatatttattgttgcggcaaagcgcacgcctgtcggctcgtttggcggcagc
ctgaaaaatgtggatgccggacatctgggcgctgccgtcattcaaggtgcactcagtgcc
gcctcactctcgcccgacgctgttgatgaagtgattgtcgggaatgtcattggtgccggg
cagggcatgagcatcggtcgtcaggcatccttattcgctggtattcctgaaaccaccccc
gcctataacattaatatggtttgtgggagtgggatgaaatcggtgatggacggtgtcagt
catattctcagtggtgatgcccaagtcgtcgttgctgcgggtgtggaggtgatgtctcaa
attccttatgccttgccgggcagtatccgtgacggtcataaaatgggtgatatgaccttg
gttgatttgttaattcgtgacggattgactgacatatttaatcaatatcacatgggctgt
accgcagaaaatattgccggagaatatgatatttcccgggaagcacaagatcagtttgca
ctgagtagtcaacaaaaagccgttgccgccatcaaggctggaaagtttgttgatgagatc
gtacctattgaagtgaaaattaagcgggatagcgtcatgttcgataccgatgagcaccct
aaagcagactcgtcaatcgagcgtttagcacgtctgcggcccgcttttatgaaagagggt
acggtgaccgccgggaatgcatccggtttaaatgatggtgccagtgccgtgatcgtcgct
tctgaaagcgccgtcaaaaaatttggtttaacaccactggttgagattgtcagctatgca
caagcgggtgttgacccgaaagtgatgggactcggtccggtacctgcggtcacgaaagcg
ctgaaacgggcaggaaaaacattagatgaaatggatctgctggaattgaatgaagcgttt
gcggctcaggcactgggcgttgtcaaaggtttatcaagagaacatgcagtttctgaagaa
gcaattcttcaaaaagcgaatgtaaacggtggagcgatcgcactcggtcatccacttggt
gcatctggaaaccgtatattggtgactctcatccacgaattgaagcggagaggtgaccag
tatggggtggcatcattatgtatcggcggaggaatgggaaccgctgtcatagtgaaagcc
gttggctaa

DBGET integrated database retrieval system