KEGG   Variibacter gotjawalensis: GJW-30_1_00246Help
Entry
GJW-30_1_00246    CDS       T05320                                 

Gene name
ltaE
Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
vgo  Variibacter gotjawalensis
Pathway
vgo00260  Glycine, serine and threonine metabolism
vgo01100  Metabolic pathways
vgo01110  Biosynthesis of secondary metabolites
vgo01120  Microbial metabolism in diverse environments
vgo01130  Biosynthesis of antibiotics
vgo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vgo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GJW-30_1_00246 (ltaE)
Enzymes [BR:vgo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     GJW-30_1_00246 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAT57738
UniProt: A0A0S3PPA1
Position
281459..282517
Genome map
AA seq 352 aa AA seqDB search
MNFASDNTAGIPAPILDAITAANEGYSLGYGNDDWTKRVEARLSELFEREVAAFLVPTGT
VANSLALAHLSPPWGAVLCHVDSHVNDDESGAPEFFGGGLKLLELPGQNAKIDPAVLTER
LSRLRGAPHSVLPSVVSITQSTELGTVYSLSEIAALAEIARSRSLKLHMDGARFGNAIAS
LGCAPAEATWKTGVDALSFGATKGGALAAEAIVFFNPADAAGMSSRRKRGGALISKHRFI
AAQFEAYLKDDLWLKLARHANAMAKRLSDGLSAAGEPPMWPVEANEVFAILSNDADARLR
KAGAAYYPWQAVALPEGRKVPQGHGLFRLVTSFATRADDVDAFLRIAHPTKP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgccagcgacaacacggcgggcattcccgccccgatcctcgacgcgatcacg
gccgccaacgagggctattccttaggctacggaaacgacgattggacgaagcgcgtcgag
gccagactctcggaattgttcgagcgcgaggtggctgccttcttggtgccgaccggcacg
gtcgcgaactcgcttgccctcgcgcatctctcgccgccctggggcgcagtgctttgccat
gtggattcccacgtcaacgacgatgaatccggcgcgcccgagttcttcggcggcggcctg
aagctgctggaactgcccggccagaacgcgaagatcgaccctgcggtgctcaccgagcgg
ctgtcccgcctgcgcggcgcgccgcatagcgtgctgccgtctgtcgtctcgatcacccaa
tcgaccgagctcggcaccgtctacagcctgtcggaaattgcggccctcgccgaaatcgcg
cgcagccgtagcctcaaactgcacatggacggtgcacgcttcggcaacgcgattgcctcg
ctcggctgcgcgccggcggaagcgacctggaaaaccggcgtcgatgccctctcgttcggc
gcgaccaagggcggcgccctcgcggccgaagccatcgttttcttcaatccggccgatgcg
gccggcatgtcctcacgccgcaagcgcggcggcgcgctgatttcaaaacaccgcttcatc
gcggcgcagttcgaggcgtatctcaaggacgatctgtggctgaagctcgcgcgccacgct
aacgcgatggcgaagcgtctgtcggacggcctgtcagccgccggcgagccgccgatgtgg
ccggtcgaagccaacgaggttttcgcaattctgtcgaacgacgccgatgcgcggctgagg
aaagccggcgcagcgtattacccgtggcaggccgtggcgctgccggaaggccgcaaagtc
ccgcagggtcacggacttttccgcctcgtcacatccttcgcgacgagagccgacgatgtc
gatgccttcttacgcatcgcacaccctaccaaaccgtaa

DBGET integrated database retrieval system