KEGG   Variibacter gotjawalensis: GJW-30_1_01781Help
Entry
GJW-30_1_01781    CDS       T05320                                 

Gene name
hldD
Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
vgo  Variibacter gotjawalensis
Pathway
vgo00540  Lipopolysaccharide biosynthesis
vgo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vgo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    GJW-30_1_01781 (hldD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:vgo01005]
    GJW-30_1_01781 (hldD)
Enzymes [BR:vgo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     GJW-30_1_01781 (hldD)
Lipopolysaccharide biosynthesis proteins [BR:vgo01005]
 Unusual sugar
  GJW-30_1_01781 (hldD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: BAT59250
UniProt: A0A0S3PTM8
Position
complement(1816579..1817550)
Genome map
AA seq 323 aa AA seqDB search
MIVVTGGGGFIGSRVVARLGEDNVPAAVIEDFTRAEKWANLRVDNLYDLVDWQDAFVWLD
ANADAVSAVVHMGAISSTTVTDLDLIRRKNVRFTLELWAWCAQHGKPLVYASSAATYGAG
EHGFLDTLSLDDLRKLKPLNMYGWSKQVADLRILRDAANGAPTPPHWYGLKFFNVYGPNE
AHKGSMRSVALKLYEQLHGSGYLTLFRSHHPDYEDGKQLRDFVYVDDVADVIVWLLRGGA
PSGLYNVGTGKAEPFLAIAEALLRETGKDVPVTYVDMPANIRDQYQYYTEADIKKLRQAG
YNGGFRDVAAGVASYVKALQSGS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgtgacgggcggtggcggcttcatcggctcgcgcgtcgtggcgcggcttggc
gaagacaatgtgccggccgccgtgatcgaagatttcacgcgcgccgagaagtgggcgaat
ctccgcgttgacaatctgtacgacctcgtcgattggcaggacgcgtttgtgtggctcgac
gcgaacgctgacgctgtctcggcggtcgtgcatatgggcgcgatttcgtcgacgacggtt
acggatctcgatctcattcgccgtaagaatgtgcggtttacgctcgagctgtgggcgtgg
tgcgctcagcatggaaaaccgctcgtttacgcctcctcggccgcgacctacggcgccggt
gagcatggttttctcgatacgctgagcctcgacgatctgcgcaagctcaagccgctcaac
atgtacggctggtcgaagcaggttgccgatctgcgcattctgcgcgatgccgcgaacggc
gcaccgacgccgccgcattggtacggcctgaaattcttcaacgtgtatgggccgaacgaa
gcgcacaaaggatcgatgcggtcggtcgccctgaagctttacgaacagctgcacggcagc
gggtacctcacgctcttccgctcgcatcatcccgattacgaagacggcaaacagcttcgc
gattttgtctacgtcgacgatgttgcggacgtgatcgtctggctgttgcggggtggcgcc
ccctctggtctctacaatgtcggcaccggcaaagccgaaccgtttctcgcgatcgcggag
gccctgctgcgtgagaccggcaaggacgttccagtgacctatgtcgacatgccggcaaat
atccgtgatcaatatcagtactacacggaggccgacatcaagaagctgcgtcaagccggc
tacaacggcggcttccgcgacgttgcggccggggtcgcctcctacgtgaaggcactgcaa
tccggttcttag

DBGET integrated database retrieval system