KEGG   Variibacter gotjawalensis: GJW-30_1_02184Help
Entry
GJW-30_1_02184    CDS       T05320                                 

Gene name
atzE
Definition
(GenBank) biuret hydrolase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
vgo  Variibacter gotjawalensis
Pathway
vgo00970  Aminoacyl-tRNA biosynthesis
vgo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vgo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GJW-30_1_02184 (atzE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:vgo03029]
    GJW-30_1_02184 (atzE)
Enzymes [BR:vgo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GJW-30_1_02184 (atzE)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GJW-30_1_02184 (atzE)
Mitochondrial biogenesis [BR:vgo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GJW-30_1_02184 (atzE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAT59651
UniProt: A0A0S3PUT3
Position
2254730..2256028
Genome map
AA seq 432 aa AA seqDB search
MTASARDRLAAALARIDDPKGEGKRACLTVYRETSEIEADAADARAKAGISLGPLDGTIV
SIKDLFDVRGEPTRAASKIYADAPPAKADAPVVQRLRAAGAVIVAKTAMSEFAFSGVGWN
PHYGTPANPADRSRVPGGSSSGAAVAAADHMCEIAIGTDTGGSTRIPAALCGVVGFKPSK
QRVPTDGAFPLSYTLDSIGPLARNVADCARADAVIAGEAAWDLKPQSVKGLRIRVPRSAS
FQPREDEVTKAFNDGLDILRKAGAIIEETPFPLLDEMIEANKTGGFPVPEALQIHRENLK
TRGDDFDQNVRARIERGSAMSAADYIELMQTRSRLVPAMDAWMSGVDVLALPATPIVAPK
IADIDKDTKAFVKANVALLSITSIFNFFDNCGISIPLPRPNGALPVGLMLIARNGRDRDL
FRVAAGVERAFA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcttccgcacgtgatcgtctcgccgccgcgcttgcccgcatcgacgatccgaaa
ggcgaggggaagcgggcatgtctcacggtctatcgagagacgtctgagatcgaagcagat
gctgccgacgcgcgcgcaaaagccggcatatcgctcgggccgctcgatggcaccattgtc
tcgatcaaggatttgttcgacgtcagaggtgagccgacgcgcgcggcctcgaagatctac
gccgacgctccgccggccaaagccgacgcgccggtggtgcagcgcctgcgcgcggcgggc
gccgtgatcgtcgccaagaccgcgatgtcggagttcgctttctcgggcgtcggctggaac
ccgcattacggcacaccggccaatccggctgatcgctcgcgcgttcctggcggctcgtca
tccggtgcggcggttgctgctgccgaccacatgtgcgagatcgcgatcggcaccgacacc
ggcggctcgacgcgcattccggccgcgctctgcggcgtcgtcggcttcaagccgtcgaag
cagcgcgtgccgaccgacggcgcgttcccgctgtcctacacactcgactcgatcggcccg
ctcgcgcgcaacgttgcggactgcgcacgtgccgacgccgtcatcgcgggggaggccgcg
tgggatctcaagccgcaatccgtgaagggtctgcgcatccgcgtgccgcgaagcgccagc
ttccagccgcgcgaagacgaagtgacgaaggctttcaacgatgggctcgacattttgcgc
aaggccggcgcgatcatcgaagagacgccgtttccgctgctcgacgagatgatcgaggcg
aacaagaccggcggcttcccggtgccggaagctttgcagattcatcgcgagaatctgaaa
acgcgcggtgacgatttcgatcagaacgttcgcgctcgtatcgagcgcggcagcgcgatg
agcgccgcggactacatcgagctgatgcagacgcgtagccgccttgtgcccgcgatggat
gcgtggatgtccggtgtcgatgtgctcgcgctgcctgcgacgccgattgtcgcgccgaag
atcgccgacatcgacaaagacacgaaagccttcgtcaaagcgaatgtcgcgttgctgtcg
atcacgtcgatcttcaatttcttcgacaattgcggaatctcgattccactcccgcggccg
aacggcgcgctgcccgtcggcctcatgcttatcgcgcgcaatggccgtgatcgcgatctc
ttccgcgtcgccgccggcgtcgaacgggctttcgcctga

DBGET integrated database retrieval system