KEGG   Vibrio campbellii: VIBHAR_00442Help
Entry
VIBHAR_00442      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K02313  chromosomal replication initiator protein
Organism
vha  Vibrio campbellii
Pathway
vha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vha00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VIBHAR_00442
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:vha03032]
    VIBHAR_00442
   03036 Chromosome and associated proteins [BR:vha03036]
    VIBHAR_00442
DNA replication proteins [BR:vha03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    VIBHAR_00442
Chromosome and associated proteins [BR:vha03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    VIBHAR_00442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA AAA_16 AAA_14 AFG1_ATPase NACHT Kinesin DUF815 ATPase_2 AAA_19 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ABU69457
UniProt: A7N1E9
Position
I:423785..425191
Genome map
AA seq 468 aa AA seqDB search
MSSSLWLQCLQQLQEELPATEFSMWVRPLQAELNDNTLTLFAPNRFVLDWVRDKYLNSIN
RLLQEYCGNDVPSLRFEVGSRPVAAPKPAPTRTPADVAAESSAPAQLQARKPVHKTWDDD
AQAIADINHRSNVNPKHKFNNFVEGKSNQLGLAAARQVSDNPGAAYNPLFLYGGTGLGKT
HLLHAVGNAIVDNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQF
FANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPEL
ETRVAILMKKAEDHQIHLADEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFV
REALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTN
HSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLIRTLSS
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcttcgctttggttgcaatgtttgcagcagcttcaagaagagctaccagctaca
gaattcagcatgtgggttcgtccgttacaagcggagctcaatgacaatactctcactctg
ttcgcacctaaccgcttcgtgttggattgggttcgcgacaagtacctgaacagcatcaat
cgtttactgcaagaatactgcggtaacgacgtacctagcctgcgctttgaagtgggcagt
cgcccagttgcagcaccaaaaccggcaccgacacgtacgccggcagacgtggctgcagaa
tcttcagcgcctgctcaactgcaagcacgtaagcctgtgcataaaacgtgggatgacgac
gcgcaagcgatcgctgacatcaaccaccgctcaaacgtgaacccaaaacacaagttcaac
aacttcgtagaaggtaagtcgaaccaattgggtcttgctgctgctcgtcaagtttcggat
aacccaggcgcagcctataacccactattcttatacggtggtacaggtttgggtaaaacc
caccttttgcacgcggtaggtaacgcgattgtggataacaatcccaacgcaaaagtggtg
tacatgcactctgagcgttttgtgcaagatatggtgaaagcactgcaaaacaacgcgatt
gaagaattcaaacgctactaccgcagtgttgatgcgctacttatcgatgacatccaattc
tttgctaataaagagcgctcacaagaagaattcttccataccttcaatgcactattagaa
ggtaaccaacagatcatcctgacatctgaccgttatccaaaagagatcagcggtgtagaa
gatcgtctgaaatcacgtttcggttggggtctaaccgtcgcgatcgagccgcctgagtta
gaaactcgtgtggcgatcttgatgaagaaagctgaagaccaccaaatccacttagcggat
gaagtggcgttctttattgctaagcgtctacgctctaacgttcgtgaactggaaggtgca
ctgaaccgcgtaatcgcaaacgcaaactttactggccgcccaattacgattgattttgtt
cgtgaagcgctgcgcgatctgcttgctctgcaagagaaattggtgacgatcgataacatt
caaaagacggtcgctgaatattacaagattaaggttgctgacctactatctaaacgtcgc
tctcgctcggttgctcgtcctcgtcagttggcgatggcgttggcaaaagagttgaccaat
cacagcttgccagaaattggcgatgcgtttggtggtcgtgaccacaccacggtgctgcat
gcatgtcgcaagattgagcagctgcgtgaagagagccacgatattaaagaagattactct
aacttgattcgcaccctgtcttcgtaa

DBGET integrated database retrieval system