KEGG   Vibrio campbellii: VIBHAR_00621Help
Entry
VIBHAR_00621      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
vha  Vibrio campbellii
Pathway
vha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vha00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VIBHAR_00621
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vha02022]
    VIBHAR_00621
Two-component system [BR:vha02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   VIBHAR_00621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: ABU69623
UniProt: A7MSS1
Position
I:606922..607641
Genome map
AA seq 239 aa AA seqDB search
MQENYKILVVDDDARLRALLERYLSEQGFQVRSVANGEQMDRLLTRENFHLMVLDLMLPG
EDGLSICRRLRHANNMLPILMLTAKGDEVDRIVGLEVGADDYLPKPFNPRELLARIKAVL
RRQTVELPGAPSTEEKVVEFGDFRLNLGTREMFRGDEAMPLTSGEFAVLKALVTNAREPM
SRDKLMNMARGREYSAMERSIDVQISRLRRMLEDDPSKPRYIQTVWGLGYVFVPDGKEA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaattataaaatattagtggttgatgacgatgctcgtttacgtgctctgttg
gagcgttacctttctgagcaaggttttcaagtgagaagtgtcgctaacggcgagcagatg
gaccgtcttctgacccgtgaaaacttccaccttatggtgttggatttaatgttgccgggc
gaagatggcttatcgatttgtcgtcgtctacgtcacgccaacaacatgctacctattctg
atgctgacagcgaaaggcgatgaagtcgatcgtatcgttggccttgaagtgggtgcagac
gattacctaccaaaaccgtttaacccgcgtgaactgcttgctcgtattaaagcagtactt
cgccgtcaaacggttgaactgccaggtgcaccaagtacggaagagaaagtcgttgagttc
ggtgattttcgtctgaatttgggtacacgtgaaatgttccgtggtgatgaagctatgcca
ctgacctcgggtgaattcgcggtgttgaaagcgcttgtgaccaacgctcgtgagccgatg
tcacgtgataaactgatgaacatggctcgtggtcgtgaatactcagcgatggaacgttct
atcgacgttcaaatctcacgtctacgccgcatgttagaagacgacccaagcaaacctcgc
tacatccaaacagtatggggcttaggttacgtgttcgtcccagacggcaaagaagcgtaa

DBGET integrated database retrieval system