KEGG   Vibrio campbellii: VIBHAR_00807Help
Entry
VIBHAR_00807      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
vha  Vibrio campbellii
Brite
KEGG Orthology (KO) [BR:vha00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    VIBHAR_00807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 DUF1854
Motif
Other DBs
NCBI-ProteinID: ABU69808
UniProt: A7MWC5
Position
I:complement(788380..788760)
Genome map
AA seq 126 aa AA seqDB search
MDVIQPCIKIQVHTKYIEEQSNPELQRYVFAYVITIKNLSQQTVQLISRRWLITDSNGKQ
MTVEGEGVVGQQPFISGSDEYTYSSGTALETPVGVMQGHYILLDEKGNEFITEIDPFRLA
IPNVLN
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcattcaaccctgcatcaaaattcaagttcataccaaatacattgaagaacag
tccaaccctgaactgcaacgctacgtttttgcttacgtcattacgataaaaaacctcagc
caacaaaccgtgcaattaatcagccgacgctggttgattaccgattccaatggcaagcaa
atgaccgtagaaggcgaaggtgtcgtcggtcagcaaccttttatttccggtagcgacgaa
tacacctacagtagtggcaccgcactggagacgccggttggagtaatgcaaggacactac
attctgctggatgaaaagggcaatgaatttatcaccgagatcgacccgttccgtttggcg
ataccaaacgtgttaaattaa

DBGET integrated database retrieval system