KEGG   Vibrio campbellii: VIBHAR_00833Help
Entry
VIBHAR_00833      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
vha  Vibrio campbellii
Pathway
vha00051  Fructose and mannose metabolism
vha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    VIBHAR_00833
Enzymes [BR:vha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     VIBHAR_00833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UPF0052 Sacchrp_dh_NADP ApbA
Motif
Other DBs
NCBI-ProteinID: ABU69834
UniProt: A7MWS7
Position
I:complement(822196..823344)
Genome map
AA seq 382 aa AA seqDB search
MKNAVHFGAGNIGRGFIGKLLADAEVEVTFADVDAPLVDQLSHKQEYKVKVVGTECQIDT
VTHVTAVNSASEDVIDRIVKTDLVTTAVGPNVLDIIAKTIATGIAKRFAAGNDKPLNIIA
CENMVRGTTHLKGEVYKHLDESLHSKADELVGFVDSAVDRIVPPAEAANDDPLEVTVESF
SEWIVDEQQFKGEIPDIAGMEKTNNLMAFVERKLFTLNTGHCITAYLGCLKGHRTIREAI
EDPSIHAEVKQAMQESGEVLIKRYGFDRDMHNAYIEKILGRFANPYLVDEVDRVGRQPIR
KLGANDRLVKPLLGTIEYGTENKTLLKGIAAALKYTNDTDPQAVEQQNSLKEVGVKKTLA
TYTGLAENSAEVTQIETLYNQL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagttcattttggcgcaggtaacattggtcgtggcttcatcggtaaacta
ttagcagacgcagaagtcgaggtgacattcgcagacgttgacgctccactcgtcgaccag
ctgagccacaagcaagaatacaaagtaaaagtggtcggtactgagtgccaaatcgacaca
gtaactcacgttaccgcggttaactcagccagtgaagatgtcatcgaccgcattgtaaaa
accgacttggtaacaacagcggttggccctaacgtactggacatcattgcaaaaaccatc
gctaccggcattgctaagcgctttgcagctggtaacgataaaccattgaacatcatcgcg
tgtgaaaacatggttcgtggcaccacacacctaaaaggtgaggtgtacaaacacttagat
gaatcattgcattcaaaagcagacgagttggttggctttgtcgattcagcggtagaccgc
atcgtaccaccagcagaagcggcgaacgatgacccactagaagtgacggtagaaagcttt
agcgaatggattgtggatgaacagcaattcaagggcgaaatccctgatatcgcaggcatg
gaaaaaaccaacaacctaatggcatttgtagaacgcaagctgttcactctcaatacaggt
cactgcattaccgcttacctaggttgcttgaaaggccatcgtactattcgtgaagcgatt
gaagacccaagtattcatgctgaagtaaaacaggcgatgcaagagagtggtgaagtgctg
atcaaacgttacggtttcgaccgtgacatgcacaatgcttacatcgagaagattctagga
cgctttgccaacccatacttagtggatgaggttgatcgcgtaggtcgtcaaccaattcgc
aaattgggtgcaaacgatagattagtgaagcctttactcggtacaattgagtatggcact
gaaaataaaacacttttgaaaggcattgccgctgcgttgaagtacactaacgacactgac
ccacaagccgtagagcaacaaaactcattaaaagaagtgggtgtgaagaagacgctagcg
acatacacaggtcttgcagaaaacagtgctgaagtgactcaaatcgagacactttacaac
caactttga

DBGET integrated database retrieval system