KEGG   Vibrio campbellii: VIBHAR_01134Help
Entry
VIBHAR_01134      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K04043  molecular chaperone DnaK
Organism
vha  Vibrio campbellii
Pathway
vha03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:vha00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    VIBHAR_01134
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vha03019]
    VIBHAR_01134
   03110 Chaperones and folding catalysts [BR:vha03110]
    VIBHAR_01134
   03029 Mitochondrial biogenesis [BR:vha03029]
    VIBHAR_01134
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vha04147]
    VIBHAR_01134
Messenger RNA biogenesis [BR:vha03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     VIBHAR_01134
Chaperones and folding catalysts [BR:vha03110]
 Heat shock proteins
  HSP70 / DNAK
   VIBHAR_01134
Mitochondrial biogenesis [BR:vha03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    VIBHAR_01134
  Matrix
   MMC/PAM proteins
    VIBHAR_01134
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    VIBHAR_01134
Exosome [BR:vha04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VIBHAR_01134
  Exosomal proteins of breast cancer cells
   VIBHAR_01134
  Exosomal proteins of colorectal cancer cells
   VIBHAR_01134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C HSP20 Lant_dehydr_C
Motif
Other DBs
NCBI-ProteinID: ABU70124
UniProt: A7MWW0
Position
I:1150240..1152156
Genome map
AA seq 638 aa AA seqDB search
MGKIIGIDLGTTNSCVAVLDGDKPRVIENAEGERTTASVVAYTDGETLVGQPAKRQAVTN
PTNTLFAIKRLIGRRFEDEEVQRDIEIMPYKIVKADNGDAWVEAQGQKMAAPQVSAEILK
KMKKTAEDFLGEEVTGAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGL
DKSGGDRTIAVYDLGGGTFDISIIEIDEVEGEKTFEVLATNGDTHLGGEDFDTRLINYLV
DEFNKEQGINLKNDPLAMQRVKEAAEKAKIELSSTSQTDVNLPYVTADATGPKHMNVKVT
RAKLESLVEDLVQRSLEPLKVALADADLSVNDITDVILVGGQTRMPMVQAKVAEFFGKEA
RRDVNPDEAVAMGAAVQGGVLAGDVKDVLLLDVTPLSLGIETMGGVMTKLVEKNTTIPTK
ANQVFSTAEDNQSAVTIHVLQGERKQASFNKSLGQFNLEGIQAAPRGMPQIEVTFDLDAD
GILHVSAKDKQTGKEQKITIQASGGLSDEDIEKMVQEAEANKEADKKFEELAAARNQADQ
MIHGTRKQVEEAGEALPAEEKEKIEAAISELETARKGDDKEAIDAKVQALMTAAQKLMEI
AQQQAQAQQAQGADADAQQSKEDDVVDAEFEEVKDDKK
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaatcattggtattgacttaggtactactaactcttgtgttgctgttctagac
ggtgacaagccacgcgtaattgaaaacgcagaaggcgagcgtacaaccgcatctgttgtt
gcatacacagacggcgaaacgctagtaggccaacctgctaaacgtcaagcagtaacaaac
ccaactaacacgctatttgcaattaagcgtctaattggtcgtcgctttgaagatgaagaa
gttcagcgtgatatcgaaatcatgccttacaaaatcgttaaggctgacaacggtgatgct
tgggtagaagcgcaaggccaaaaaatggcggctcctcaagtttcagctgaaatcctgaag
aaaatgaagaaaactgctgaagacttcctaggtgaggaagtaactggcgcagttatcaca
gttcctgcttactttaacgatgctcaacgtcaagctacaaaagacgctggccgtatcgca
ggtctagaagttaaacgtatcatcaacgaaccaacagcggctgcactagcatacggtcta
gacaagtcaggcggcgaccgcactatcgcggtatacgaccttggtggtggtacattcgat
atctctatcatcgaaatcgatgaagttgaaggcgaaaaaacgttcgaagttctagcaact
aacggtgacactcaccttggtggtgaagactttgatacgcgtctaatcaactacctagta
gacgagttcaacaaagagcaaggtatcaatctaaagaacgacccactagcgatgcaacgt
gttaaagaagcagcagaaaaagcgaagatcgagctttcttctacttctcaaactgacgta
aacctaccttacgtgactgcagacgcgactggtcctaagcacatgaacgtgaaagtgact
cgtgcgaaactagaatctctagttgaagaccttgtacaacgttctcttgagccactaaaa
gttgctctagctgacgctgacctatctgtaaacgacatcactgacgtaatcctagttggt
ggtcagactcgtatgcctatggttcaagcgaaagttgctgagttcttcggtaaagaagct
cgccgcgatgtaaaccctgatgaagcagtagcaatgggtgctgcagttcaaggtggtgta
cttgcgggtgacgttaaagacgtacttctactagacgttactccactgtctctaggtatc
gagacaatgggcggtgtaatgactaagttagttgagaaaaacacaactatcccaactaaa
gcgaaccaagttttctctacagcagaagataaccagagcgcggtaactatccacgttctt
caaggtgagcgtaagcaagcgtctttcaacaaatctctaggtcaattcaacctagaaggt
atccaagctgcaccacgtggtatgccacaaatcgaagttactttcgacctagatgcggat
ggtatcctacacgtttcagcgaaagacaagcagactggtaaagagcagaagatcactatc
caagcttctggcggtctaagcgacgaagacatcgagaaaatggttcaagaagcagaagct
aacaaagaagcggacaaaaagttcgaagagctagcggctgcacgtaaccaagctgaccaa
atgattcacggtactcgtaagcaagtagaagaagctggtgaagcactacctgcagaagag
aaagagaagattgaagcagctatctctgagctagaaactgcacgtaaaggcgatgacaaa
gaggcgatcgacgctaaagttcaagcgctaatgacggcagctcaaaagctaatggaaatc
gctcaacaacaagctcaagcgcaacaagcacaaggtgctgacgctgatgctcaacagtct
aaagaagacgacgtagttgatgctgagttcgaagaagttaaagacgacaagaaataa

DBGET integrated database retrieval system