KEGG   Vibrio campbellii: VIBHAR_01335Help
Entry
VIBHAR_01335      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
vha  Vibrio campbellii
Pathway
vha00520  Amino sugar and nucleotide sugar metabolism
vha01100  Metabolic pathways
vha01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VIBHAR_01335
Enzymes [BR:vha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     VIBHAR_01335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ABU70312
UniProt: A7MT39
Position
I:complement(1344847..1345983)
Genome map
AA seq 378 aa AA seqDB search
MYALSNCKIYTGSDVLTDHAVIIDNDQIQSVVPVTQLPEGIEVKDLDGANLSPGFIDLQL
NGCGGVMLNDEITPETMQIMHEANLKSGCTSFLPTLITSSDEDMRASIAAAREYHNKYQN
QSLGLHLEGPYLNVAKKGIHSVDFIRPSDDGMIDLICANADIIAKVTLAPEQNDPEHISR
LKAAGIVVSIGHTNATYAEARQGFEAGITFATHLFNAMTPMVGREPGVVGAIYDTPEVYA
GIIADGFHVDYANIRIAHKIKGEKLVLVTDATAPAGADIDHFIFVGKKVYYRDGKCVDEN
GTLGGSALTMIEAVQNTVEHAGIALDEALRMATLYPATAIGVEDRLGRVRKGMVANLTVF
DRDFNVKATVVNGQYEQN
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcgctaagtaactgtaaaatctataccggtagtgatgttcttaccgatcatgct
gtcatcatcgacaatgaccagattcaatcagttgtgccagtgactcaactaccagaaggt
attgaagtaaaagatctggacggtgctaacctaagccctggttttatcgacctacagcta
aacggctgtggcggtgtgatgcttaacgacgaaatcacaccagaaacaatgcaaatcatg
catgaagcaaaccttaaatctggttgtacaagctttctacctactctaatcacatcttca
gacgaagacatgcgcgcttcgattgctgcagctcgtgagtaccacaacaaataccaaaac
caatcgctaggtttgcatcttgaaggtccgtacctaaacgtagcgaaaaaaggtattcac
agcgttgacttcatccgcccttctgacgacggtatgattgacctgatttgcgcaaacgca
gacatcattgcaaaagtaacgctagctccagaacaaaatgaccctgagcatatctctcgt
ttgaaagcggctggcatcgtggtttctatcggtcacaccaacgcaacatacgcagaagca
cgtcaaggtttcgaagcaggtatcacatttgccactcacctattcaatgcgatgacgcca
atggttggccgtgaaccaggtgtggttggtgcgatttacgacaccccagaagtttatgca
ggtatcattgcagacggtttccacgttgattacgcaaacattcgaattgctcataaaatc
aagggcgaaaagcttgttttggtgacggatgccacagctccagcaggtgctgacattgat
cactttatttttgtcggtaagaaagtatattaccgagatggtaagtgtgttgatgaaaat
ggcacactaggcggctcagctctgactatgatcgaagcagttcagaatacagttgagcac
gcaggcatcgctttagacgaagctctacgaatggctacactgtacccagcaaccgcaatc
ggtgttgaggaccgtcttggccgagttcgaaaaggtatggtagcaaaccttactgttttc
gatcgtgacttcaatgtaaaagcgacggttgttaacggacaatacgagcaaaattaa

DBGET integrated database retrieval system