KEGG   Vibrio campbellii ATCC BAA-1116: VIBHAR_01401
Entry
VIBHAR_01401      CDS       T00589                                 
Name
(GenBank) hypothetical protein
  KO
K02364  L-serine---[L-seryl-carrier protein] ligase [EC:6.3.2.14 6.2.1.72]
Organism
vha  Vibrio campbellii ATCC BAA-1116
Pathway
vha01053  Biosynthesis of siderophore group nonribosomal peptides
vha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    VIBHAR_01401
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:vha01008]
    VIBHAR_01401
Enzymes [BR:vha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.72  L-serine---[L-seryl-carrier protein] ligase
     VIBHAR_01401
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     VIBHAR_01401
Polyketide biosynthesis proteins [BR:vha01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    VIBHAR_01401
SSDB
Motif
Pfam: AMP-binding Condensation Thioesterase AMP-binding_C PP-binding Abhydrolase_6 Abhydrolase_1 Hydrolase_4
Other DBs
NCBI-ProteinID: ABU70377
UniProt: A7MT06
Position
I:1415170..1419123
AA seq 1317 aa
MNMYDLPYTAEQLLPLTDAQAGIWFAQLRDPENPIYKTGEYLVIDGKVDEPCFVEAVKTA
IDEVDSLHAKFVTTTEGPRMVIDRQNWQVERIDFSQQDAPLDAAVDWMKSELKQPVDLEQ
GPLFVMALLKLSEDQFVWFLSLHHIAIDGYSMSLVAGRVAHIYGQLAQGKPFDKIEFVDQ
QALLKEDDDYKASEKYQKDRAFYLQRYADHSDTVNLAGKPTVTSDRFLRLKGAMEVDDFQ
RMESLAKQCRTHWYSVLIASIAAYVHRMTRSNEVVLGVPLMGRLGSVAIQTPAMRVNILP
VRVSFEQGLDIKMLVKQVNQEFSSVRRHQSYRYEELHRELNLVKDNRNLFGPLVNIMPFE
YEHKFGELNSKAHNLSAGPVDDISFYCYELDGQLHIDMDANPELYSEKDIHEHQQRLFHF
MSDFFAIAQAQDPALCQVSDINILLAGEREKVIETWNDTDHEVPETTLAALLARQRILTP
HSPAIIFEGQKLSYEELAKKVYSLTNWLTAEGVTLGDRIAVCVPRSEELIVVQQAILAAG
AVYVPVDPDYPEGRIHYMLESSAPKFVFSTSALQDKLPHGVEVKLVDDDTLPTIYKRVEP
LPPQVKPEPHSPAYMIYTSGSTGKPKGVVVTHDAIVNRLLWMHDQYPITAKDRVLQKTPA
GFDVSVWEFFWPMMVGSCLVIAKPDGHKDPIYLQDLIHREKITTLHFVPSMLQIFVQQAD
PDLCQSLRQVFCSGEALPIELVNHYYQAFNAPLHNLYGPTEAAVDVTYWPSEANTEGTSI
PIGRPVWNTQIYILDDALNPVPPGVVGHLYIAGRQLAQGYHGQPELTAERFIENPFGPQG
SRMYLSGDLARWREDGAIEYCGRSDFQVKIRGFRIELEEIENALANHPSVAQVAVLAQEY
NDGDKRLVAYVTAENTEQGIDSNALQTYLAEPLPEYMVPSYFVELEAFPLTPNGKLDRSA
LPKPDLSGQVGTKGPSNLVEERLCKLFCQLLDLPAVGVDDNFFELGGHSLLAAQLIAHVK
EIMGIELSLAAVFESPTVSGIAAKLNGSESDDALSILLPLRQREGKAAIFCVHPAGGLSW
CYAALTPIIPSNVPLYGVQARNLGDPSAPLPKSMKEMAEDYVAAIREEQPFGPYHLLGWS
IGGMIVHLMAGILQEQGQEVGLVTLLDSYPTEQWQTIHPPGEEQALGALIRMAGVEFDEA
AHSSITKPEVIDILQDAGSSMAHLSTETITAMIEVVINNNQRVRDAVDYHYQGDVLFFNA
EKPPEESFLDRNGWFKYMEGDLKVVDVACLHRDMMRPEMLRLIGTHMVKELRERFDV
NT seq 3954 nt   +upstreamnt  +downstreamnt
atgaacatgtacgatttaccttatacagcggagcaactgttgccgctgacggatgcccaa
gccgggatttggtttgcccagttgcgcgatccagaaaatccaatttacaagacaggtgaa
tacctagtgattgatggcaaggtggatgagccttgttttgttgaagcggttaaaacggcg
attgatgaggtagattccttacacgctaagtttgtcaccaccaccgaaggcccgcgcatg
gtgattgaccgccaaaactggcaggtagagcgaatcgatttctcacaacaagatgcaccg
ctggatgcagccgttgattggatgaagtcagagctgaaacaacctgtcgatttagagcaa
ggcccattattcgttatggcattgctcaagctttcagaagaccagttcgtgtggttccta
tcgctgcatcacatcgcgattgatggctacagcatgtccttggtggcgggacgcgtggca
catatttatggccaacttgctcaggggaaaccattcgacaagatcgagtttgtcgaccag
caagccttgctaaaagaagacgacgactacaaagcgtcggagaaataccaaaaagatcgc
gctttctatcttcaacgttacgcagaccattcagataccgtcaaccttgcaggcaaaccg
accgttacatcagaccgctttttacgtttaaaaggcgcgatggaggtcgacgatttccaa
cgtatggaatcactggcgaaacagtgtcgcacccactggtacagcgtgctcattgcatct
attgccgcttatgtgcaccgtatgacgcgttctaatgaagttgttcttggtgtgcctttg
atggggcgtttaggttctgttgcgattcaaacaccagcgatgcgcgtgaacattttgccc
gtgcgcgtcagctttgaacaaggcttggatattaagatgctggtcaaacaggtcaaccaa
gagttttcctcggttcgtcgtcaccaaagctaccgttatgaagagcttcaccgtgagctt
aacttggtaaaagacaaccgtaacctatttggccccttggttaatatcatgccgtttgaa
tacgagcataaatttggcgagcttaattccaaagcgcataacttgtccgctggtccagtg
gatgatatctcgttttattgttacgagcttgatggtcagcttcatatcgatatggatgcc
aatcctgagttgtattccgagaaagatattcacgagcatcaacagcgtttgttccacttt
atgagcgacttttttgcaatcgcgcaagctcaagatccagctctttgccaagtcagcgat
atcaatattcttcttgctggtgagcgagagaaagtcatcgaaacttggaacgacactgac
cacgaggtacccgagacgacgttagccgctctgttggcaaggcagcgtattcttaccccc
cattcaccagcaataatctttgaaggccaaaagctcagctacgaagagttagcgaaaaaa
gtctactcgttgaccaactggctgacggcagaaggcgttactctgggtgatcgcatcgcg
gtatgtgtgccaagaagtgaagagttgatcgttgtacagcaggcgattctggccgcaggt
gcggtttatgtaccggtggacccagattatccagagggccgtattcactacatgctagag
tcctctgcgcctaagtttgtgttctctacgtcggcactgcaagacaagttgccgcacggt
gtggaagtgaaactggtcgatgatgacaccttgccaaccatttacaaaagagtcgagcca
ctgcctccgcaagtgaagccagagccgcactctccggcctacatgatttacacctctggt
tcgacgggcaaaccaaaaggtgtggtggtcacccatgatgcgatcgttaaccgattgcta
tggatgcatgaccaatatccgattactgcgaaagatcgcgtgttgcaaaaaacgcctgcg
ggctttgatgtgtcggtgtgggagttcttttggccaatgatggttggctcatgtttagtg
atcgcgaaaccggacggacacaaagatccgatttatctgcaagatcttattcatcgcgag
aagatcaccacgctgcactttgtgccatctatgctgcaaatctttgttcagcaggcggac
cccgatttatgtcaaagcttacgccaagtgttctgtagcggtgaagcgttgcctatcgag
ttagttaatcactattaccaagcattcaacgcgcctctgcataacctttatggcccaaca
gaagcggctgtggatgtgacttattggccaagtgaagccaataccgaaggcacgtcgatt
ccaatcgggcgtccagtgtggaacacgcaaatctacattcttgatgatgcattaaatcca
gtaccgccgggtgtggtagggcacttgtacattgctgggcgacaattggcacaaggctac
catggtcagccagaactgacggcagaacgctttatcgaaaatccatttggtccacaaggt
agccgaatgtatctatcgggcgatttggctcgttggcgtgaagatggtgcgattgagtac
tgtggccgtagtgactttcaggtcaagatccgcggtttccgtattgagctggaagaaatt
gagaatgccttggccaaccatccaagtgttgctcaagtggcagtgttggctcaggaatac
aatgacggcgacaaacgcttggttgcttacgtcactgcagagaatactgagcagggtatc
gatagcaatgcattgcaaacgtacctcgcggaaccactgccagagtatatggtgccgagc
tactttgttgagcttgaagcctttccattaacgcctaacggcaaattggaccgcagcgca
ctaccgaagccggatctgtctggtcaagtcggtaccaaggggccaagtaacttagttgaa
gagcgtttgtgtaagttgttctgtcagttattggatctgcctgcggtcggtgtggatgac
aacttcttcgagcttggcgggcactccctattggctgcgcagttgattgcccacgtgaaa
gaaatcatggggattgagttgtcattggcggcggtatttgaatcgccaacggtttccggt
atcgcggccaagctcaacggcagcgaaagtgatgatgcactgagcattttgttaccgctg
cgtcagcgtgaaggcaaagcggctatcttctgtgtacaccccgctggtggtctgagttgg
tgttacgcggcactgacgccaatcattccgtctaatgttccgctttatggtgtccaagct
cgtaaccttggtgacccttctgcaccattaccaaagagcatgaaggagatggcagaagac
tacgtggctgcgattcgtgaagagcaaccctttggaccttaccatcttctgggttggtcg
attggcggcatgattgttcacctaatggcgggcatcttacaagagcaaggccaagaggtg
ggcttagtcacgttgctggattcttatcctacagagcagtggcaaaccattcatccaccg
ggagaagagcaagcgcttggtgcactgatccgtatggcgggggttgagtttgatgaagcc
gctcattccagcatcactaagccagaggtgatcgacatcctgcaagatgcaggttcttcc
atggcgcacctgagcaccgagaccatcacagccatgattgaggtggtgatcaacaacaac
cagcgtgtacgtgatgcggtggattaccactaccaaggtgatgtgttgttcttcaacgct
gagaagccaccagaagagtcgttcctcgatcgtaatggctggttcaagtacatggagggc
gacctcaaagtggttgatgtggcctgtttgcaccgtgacatgatgcgtccagagatgctg
cgtttgattggtacccacatggtgaaagagctaagagagaggttcgatgtttga

DBGET integrated database retrieval system