KEGG   Vibrio campbellii: VIBHAR_01631Help
Entry
VIBHAR_01631      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vha  Vibrio campbellii
Pathway
vha00071  Fatty acid degradation
vha00072  Synthesis and degradation of ketone bodies
vha00280  Valine, leucine and isoleucine degradation
vha00310  Lysine degradation
vha00362  Benzoate degradation
vha00380  Tryptophan metabolism
vha00620  Pyruvate metabolism
vha00630  Glyoxylate and dicarboxylate metabolism
vha00640  Propanoate metabolism
vha00650  Butanoate metabolism
vha00900  Terpenoid backbone biosynthesis
vha01100  Metabolic pathways
vha01110  Biosynthesis of secondary metabolites
vha01120  Microbial metabolism in diverse environments
vha01130  Biosynthesis of antibiotics
vha01200  Carbon metabolism
vha01212  Fatty acid metabolism
vha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VIBHAR_01631
   00630 Glyoxylate and dicarboxylate metabolism
    VIBHAR_01631
   00640 Propanoate metabolism
    VIBHAR_01631
   00650 Butanoate metabolism
    VIBHAR_01631
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VIBHAR_01631
   00072 Synthesis and degradation of ketone bodies
    VIBHAR_01631
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VIBHAR_01631
   00310 Lysine degradation
    VIBHAR_01631
   00380 Tryptophan metabolism
    VIBHAR_01631
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VIBHAR_01631
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VIBHAR_01631
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VIBHAR_01631
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vha04147]
    VIBHAR_01631
Enzymes [BR:vha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VIBHAR_01631
Exosome [BR:vha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VIBHAR_01631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABU70600
UniProt: A7MTK9
Position
I:1637798..1638985
Genome map
AA seq 395 aa AA seqDB search
MENKDVFVISAYRTPLGSFGGALSGIPATELGAIVIKFMLDQHDIDAAHVDEVIVGQVLT
AGCGQNPARQTAIIAGIPEYSSAFTINKVCGSGLKALQLAYQAIKNGDADLVIAGGQENM
SQAPHILPNSRNGVKMGGWKAEDSMIKDGLWDVFNDYHMGKTAENIANQYDISREEQDEF
AYKSQMKAAYAIKNNRFKDEIVPVVVPHKRNDSLVFVEDEFPRPATTKDVLSKLRPAFDE
VGSVTAGNASGVNDGAAMVILASERKVQELGLNPIARLVNFATAGVDPAIMGTGPINASR
KVLDKCDWSIGELDLIESNEAFAAQAIAVNQEMQWDSNKVNVNGGSIAFGHPIGASGARI
FVTLVNELKRQKLKKGLATLCIGGGMGIAATVEML
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaagatgtttttgttataagtgcatatagaacaccattaggttcttttggt
ggggcactttctggtattccggcaactgagttgggtgcaatagtgataaaatttatgtta
gatcagcatgatattgacgctgctcatgtagatgaagtgatcgtcgggcaagtattgact
gctggctgcggacaaaacccggcccgccaaactgcaatcattgctggtattccagagtat
tcttcagctttcacaattaataaggtctgtggttcaggattaaaagctctacagcttgct
tatcaggctattaaaaatggagacgcagacctagtgattgcagggggacaagagaatatg
agtcaagcccctcatattctgccaaattcacgcaacggtgtgaaaatggggggatggaaa
gctgaagatagtatgatcaaagatggcctatgggatgtatttaacgactatcatatgggc
aaaactgcagaaaacattgcaaatcaatacgatatatctcgtgaagaacaagatgaattt
gcttacaagtcccagatgaaggcagcgtatgcaataaaaaacaaccgattcaaggacgaa
attgttccggttgtcgtgcctcataaacgcaatgattcccttgtttttgttgaagacgaa
tttccgcgcccagctaccaccaaagatgttttatcaaaactccgtcctgcatttgatgaa
gtaggtagtgtaactgcggggaatgcttctggagtcaatgatggagctgcgatggttatt
cttgcgtctgaacggaaagtacaagaattaggcttaaacccgattgctcgtcttgtgaat
tttgctactgccggagttgatcctgccattatggggactggaccaatcaatgcttctcgc
aaagtcttagataaatgcgattggagtattggagagctagaccttattgagtccaacgag
gcgtttgctgctcaagctatcgcggtaaaccaagaaatgcaatgggatagcaataaggtc
aatgtcaatggaggctctattgcatttgggcatccaattggagcctctggcgctcgtatt
tttgtcactctagtcaatgaattgaaacgtcagaaactcaaaaaggggttagcgacttta
tgtattggaggcgggatgggaatcgctgccaccgtagaaatgctttaa

DBGET integrated database retrieval system