KEGG   Vibrio campbellii: VIBHAR_02330
Entry
VIBHAR_02330      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K09911  uncharacterized protein
Organism
vha  Vibrio campbellii
Brite
KEGG Orthology (KO) [BR:vha00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    VIBHAR_02330
SSDB
Motif
Pfam: MatP MatP_C FAS_I_H CcdA RHH_4 APG6_N
Other DBs
NCBI-ProteinID: ABU71292
UniProt: A7N0M1
Position
I:complement(2320429..2320878)
AA seq 149 aa
MKYQQLENLECGWKWKYLIKKWKDGEAVTRYIDTSEADAAIAELRKLEHEPTQVLAWIEN
HMSEALDNKLKQAIRAKRKRHFNAEQVHTKKKSIDLDYRVWEKLSNRANELGCTLSDAIE
YLLSEASRSEKASMKVSSLKEDLSKLLSS
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaaatatcagcagcttgaaaatttagaatgtggttggaaatggaagtatctcattaaa
aagtggaaagatggtgaagccgttactcgatacatcgatacaagcgaagccgatgctgcg
attgctgaacttcgtaaactcgagcatgaacctactcaagttcttgcttggattgagaac
cacatgtcagaagcgcttgataacaagctgaaacaagcgatccgtgcaaagcgtaaacgt
catttcaatgcggagcaagtccacacaaagaaaaaatccatagatcttgactatcgagtg
tgggaaaagctctctaacagagcaaacgagctaggttgcacactatccgatgccattgag
tatttgctgtcagaagcatctcgaagcgagaaagcgagcatgaaggtatcatcgttgaaa
gaagacttgagtaaattgttgtccagctaa

DBGET integrated database retrieval system