KEGG   Vibrio campbellii: VIBHAR_02927Help
Entry
VIBHAR_02927      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
vha  Vibrio campbellii
Pathway
vha00450  Selenocompound metabolism
vha00970  Aminoacyl-tRNA biosynthesis
vha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    VIBHAR_02927
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    VIBHAR_02927
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vha01007]
    VIBHAR_02927
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vha03016]
    VIBHAR_02927
Enzymes [BR:vha01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     VIBHAR_02927
Amino acid related enzymes [BR:vha01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   VIBHAR_02927
Transfer RNA biogenesis [BR:vha03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    VIBHAR_02927
 Prokaryotic type
   Other AARSs
    VIBHAR_02927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1e tRNA-synt_1 tRNA-synt_1f FeoC PhnA_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: ABU71880
UniProt: A7MZT3
Position
I:2949110..2951095
Genome map
AA seq 661 aa AA seqDB search
MLEHIQADIWVRYQRLRGNTVNFICADDAHGTPIMLKAQQMGITPEEMIAAVSEEHQKDF
AGFDISFDNYHSTHSEENRELASHIYLELKKNGFISSRTISQLFDPEKEMFLPDRFVKGT
CPKCKSEDQYGDNCDNCGETYSPTELIDPKSAVSGATPVMKDSEHFFFDLPQFESMLKEW
TRSGSLQSETANKMQEWFESGLQQWDISRDAPYFGFEIPGEENKFFYVWLDAPVGYMASF
KNLCDKTEGLDFDEYWKKDSSTELYHFIGKDIVYFHSLFWPAMLEGSGFRKPNNVFVHGY
VTVNGAKMSKSKGTFVKASTYLKHLDPECLRYYYAAKLNSRIDDLDLNLEDFTQRVNADV
VNKIVNLASRNAGFISKRFEGKLAENFAEPELYNEFVAAADRIAELYETREFGRAIREIT
ALADKANQYVDEKAPWVVAKEEGKDQELQEICSVGINLFRVLMTYLKPVMPALAARTEAF
LNQELTWEGIAAPLTGHEITKFKALFNRIDPKNIEAMIEASKEDAAAEMAAKEKAEAEKN
KASQTELDKDPIAEEIEFDAFAAVDMRIARIISCEEVPKANKLLKFQLDIGGETRQVFSG
IKSAYKPEELEGKLTVMVANLKPRKMKFGMSEGMILAAGPGGSDLWILEPHEGAQPGMRV
M
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagcacattcaagctgacatctgggttcgctaccaacgcctacgtggcaacact
gtaaacttcatctgtgctgacgatgctcacggcacgccaatcatgctaaaagcacaacag
atgggtattacgccagaagagatgatcgctgcagtaagcgaagagcatcaaaaagacttc
gctggctttgatattagctttgataactaccacagcacacactcagaagagaaccgtgag
ctagcttctcacatctatcttgagctgaagaaaaacggttttatctctagccgcactatc
tctcagttgttcgatcctgagaaagaaatgttcctaccggatcgtttcgtaaaaggtact
tgtcctaagtgtaagtcagaagaccaatacggtgacaactgtgataactgtggtgagacg
tacagcccaactgagctgatcgatccaaaatcagcagtttctggcgccactccagtcatg
aaagactctgagcacttcttcttcgacctaccccagttcgaaagcatgctaaaagagtgg
actcgttcaggctctctacaatctgaaacggctaacaaaatgcaagagtggttcgaatca
ggcctgcaacagtgggatatctcacgtgatgcgccttacttcggcttcgagatcccgggc
gaggaaaacaagttcttctacgtatggctagacgcgcctgttggttacatggcttctttc
aagaacctatgtgacaaaactgaaggtctagacttcgacgagtactggaagaaagacagc
tcgactgagctataccacttcatcggtaaagacatcgtttacttccactcgctattctgg
ccagcaatgctagaaggcagcggtttccgtaagccaaacaacgtattcgtacacggctac
gtaacggtaaacggcgcgaagatgtctaagtctaaaggtacgtttgttaaagcaagcacg
tacctaaaacacctagacccagagtgtctgcgttactactacgcggcaaaactaaacagc
cgtattgacgacctagaccttaaccttgaagacttcactcaacgtgttaacgctgacgta
gtaaacaagattgttaacctagcttctcgtaacgctggcttcatctctaaacgttttgaa
ggcaagcttgctgaaaactttgcagagcctgagctatacaacgaattcgttgcagcagca
gaccgtatcgcagagctttacgagactcgtgagtttggccgtgcgatccgtgagatcacg
gcgctagcagataaagctaaccaatacgttgatgaaaaagcaccttgggttgtagcaaaa
gaagaaggtaaagatcaggaactacaagaaatttgttctgtaggtattaacctgttccgc
gttctgatgacttacctgaaaccagtgatgcctgcactagcagcgcgtactgaagcattc
ctaaaccaagagctaacttgggaaggcattgctgcaccactaactggtcacgagatcact
aagttcaaagcgctgttcaaccgtatcgatcctaagaacatcgaagcgatgatcgaagca
tcaaaagaagatgcagcagccgaaatggcagcaaaagaaaaagcagaagctgaaaagaac
aaagctagtcaaactgagctagataaagatccaatcgctgaagagattgagttcgatgct
ttcgcagcggttgatatgcgtattgctcgcatcatctcttgtgaagaagtgccaaaagca
aacaaactgcttaagttccaactagacatcggcggtgaaactcgtcaggtgttctctggc
attaagtcagcgtacaaacctgaagagctagaaggcaaactaaccgtaatggtagcgaac
ctaaaacctcgtaagatgaagtttggtatgtctgaaggcatgatcctagcagcaggccct
ggcggcagtgacctatggatcctagagccacacgaaggtgctcaaccaggtatgcgtgta
atgtaa

DBGET integrated database retrieval system