KEGG   Vibrio campbellii: VIBHAR_03053Help
Entry
VIBHAR_03053      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
vha  Vibrio campbellii
Brite
KEGG Orthology (KO) [BR:vha00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:vha03009]
    VIBHAR_03053
Enzymes [BR:vha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     VIBHAR_03053
Ribosome biogenesis [BR:vha03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    VIBHAR_03053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_32 Methyltransf_12 Ubie_methyltran MTS CheR CMAS FtsJ DLH Methyltransf_33 zf-MIZ Aldo_ket_red Methyltransf_9
Motif
Other DBs
NCBI-ProteinID: ABU72003
UniProt: A7MUG7
Position
I:3076159..3077112
Genome map
AA seq 317 aa AA seqDB search
MPLIQHPKREDSKRFFVSLAASLFDRICRPTSSPEIVMNYQCPLCHQPLELTAKTFKCEN
NHQFDLAKEGYVNLMPAHHKRSKDPGDNKEMMQARRRFLEGNHYDPMRQEVARLCAKYTE
GTSHQLLDIGCGEGYYTDQVQQSLHAQNEAANVYGLDISKVAIRYASKRYPNCDFSVASS
HRLPFAEQSLDAILRIYAPCKAEELQRVIKDSGVVITVTPAGRHLYQFRKRIYQEIRLHN
EEPESIEGFELEHQQKLNYVMDLKDGVAFDLLQMTPFAWKASDELREELKSSTLFQCEAD
FMLRVYRKKSAQSENEE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcattcagcacccaaagcgcgaggactcgaagcgcttttttgtttcgcttgcc
gcatccctttttgatagaatttgccgccctacttccagtccagagatcgtcatgaactat
caatgtcctctatgtcaccaacctcttgagctcacagctaagacgtttaagtgtgaaaac
aatcatcaattcgacttagcaaaagaaggctacgtcaacttgatgcctgcacatcacaaa
cgctcaaaagatccaggtgacaacaaagaaatgatgcaagcacgtcgtcgtttcctagaa
ggcaaccattacgatccaatgcgccaagaagttgctcgcctgtgtgcgaagtacaccgaa
ggcacaagccatcagctattggacattggttgtggtgaaggctactacaccgatcaagtt
cagcagtctctgcatgctcaaaatgaagcggcaaatgtttacggcttggacatctctaaa
gtcgctattcgttacgcctctaagcgctaccctaactgcgatttcagcgtggcatccagt
catcgcctaccttttgcagagcaatctctggatgcgattttacgcatctacgcaccatgt
aaagcggaagagctgcaacgtgtaattaaagatagcggtgtggtcattacggtaacgcca
gcaggtcgtcacctatatcaattccgcaagcgtatctatcaggaaattcgtttgcacaac
gaagaaccagaaagtatcgaaggattcgaactggagcatcaacaaaagcttaactacgtc
atggatttaaaagatggcgtggcattcgatttactgcaaatgaccccatttgcatggaaa
gccagcgatgaacttcgtgaagagctaaagtcatctacacttttccaatgtgaggctgat
tttatgttacgagtatatcgtaagaaatcagctcaatctgagaatgaagaataa

DBGET integrated database retrieval system