KEGG   Vibrio campbellii: VIBHAR_03120Help
Entry
VIBHAR_03120      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vha  Vibrio campbellii
Pathway
vha00071  Fatty acid degradation
vha00280  Valine, leucine and isoleucine degradation
vha00281  Geraniol degradation
vha00310  Lysine degradation
vha00362  Benzoate degradation
vha00380  Tryptophan metabolism
vha00410  beta-Alanine metabolism
vha00640  Propanoate metabolism
vha00650  Butanoate metabolism
vha00903  Limonene and pinene degradation
vha00930  Caprolactam degradation
vha01040  Biosynthesis of unsaturated fatty acids
vha01100  Metabolic pathways
vha01110  Biosynthesis of secondary metabolites
vha01120  Microbial metabolism in diverse environments
vha01130  Biosynthesis of antibiotics
vha01200  Carbon metabolism
vha01212  Fatty acid metabolism
Module
vha_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VIBHAR_03120
   00650 Butanoate metabolism
    VIBHAR_03120
  Lipid metabolism
   00071 Fatty acid degradation
    VIBHAR_03120
   01040 Biosynthesis of unsaturated fatty acids
    VIBHAR_03120
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VIBHAR_03120
   00310 Lysine degradation
    VIBHAR_03120
   00380 Tryptophan metabolism
    VIBHAR_03120
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VIBHAR_03120
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VIBHAR_03120
   00281 Geraniol degradation
    VIBHAR_03120
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VIBHAR_03120
   00930 Caprolactam degradation
    VIBHAR_03120
Enzymes [BR:vha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VIBHAR_03120
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VIBHAR_03120
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VIBHAR_03120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABU72069
UniProt: A7MS61
Position
I:complement(3148708..3150822)
Genome map
AA seq 704 aa AA seqDB search
MSEQKAFSLKIDEQNIAWLAIDVPNEKMNTLQAAFADEMKEIFAQLKDTSGVKGMVIHSL
KPDNFVAGADVRMLEACTTASEAEALAKQGQELFQQLSDLPYPVVAAIHGPCLGGGLELA
LACDYRVCTDSDKTRLGLPEVQLGLLPGSGGTQRLPRLIGLLPSLDLILTGKQLRAKKAK
KLGVVDACVPETVLLDIAKMHVEKGKKKGKQKQSTKEKLMSGSGLGRKFVFEQAAKKTNE
KTRGNYPATVAILEVIQHGLEKGFAQGQELEAKRFGELVMSSESKALRSIFFATTEMKKE
NGAEAEPTAVNKVGVLGGGLMGAGISHVSVAKAKVPVRIKDVSNDGVLNALNYNYKLFEK
QRKRRIISKAGLQSKMLQLSGGIDFTSFNHIDVVIEAVFEDLDLKQAMVADIEANAKPET
IFATNTSSLPIHKIAEKAERPENIVGLHYFSPVEKMPLVEVIPHETTSEETISTVVALAK
KQGKTPIVVKDKAGFYVNRILAPYMNEAAHILLANEPIEQLDGALLDFGFPVGPITLLDE
VGVDIGAKIMPILVNELGERFKGPDVFDTLLNDGRKGRKTGKGFYTYKGKKKEVDKSVYK
LLNLTPESKLSDNDIALRCVLPMLNEAVRCLDDGIIRSPRDGDIGAIFGIGFPPFLGGPF
CYMDQFGLKELVEKMNEFASKYGDRYAPCDGLLTRAGEGRNFYD
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaaaaagcatttagtctaaagattgatgagcagaacattgcttggctagcc
atcgatgtgccaaatgagaaaatgaacacgctgcaagcggcatttgcagatgagatgaaa
gaaattttcgctcaactgaaagacaccagcggcgtgaaagggatggtcattcattcccta
aaaccagataactttgttgcgggcgccgacgttcgtatgcttgaagcgtgcacaacggcg
agtgaagcggaagcattggctaagcaaggtcaagagttattccagcagctatctgatctg
ccttacccagttgttgctgcgattcacggcccatgtctaggtggtggtttagagcttgcg
ctagcgtgtgattaccgcgtatgtactgattccgataaaacgcgtcttggtttgcctgaa
gtgcaacttggtttgttgcctggttctggtggtactcaacgtcttccgcgtttgattggt
ctattaccttcgctggatttaatccttacaggcaaacaactgcgtgcaaagaaagcgaaa
aagttgggtgtggttgacgcatgtgtgccagagactgtcttactcgatatcgcgaagatg
catgtcgaaaaaggcaagaagaaaggtaaacaaaagcaatcgacaaaagagaagttgatg
tcgggtagtggtttaggtcgtaagtttgtgtttgagcaagccgcgaagaaaaccaatgaa
aagacccgtggtaactaccctgcaacggtcgcgattctagaagtgatccagcatggtctt
gaaaagggctttgcccaaggtcaagaacttgaagcgaagcgctttggcgaattggtgatg
agttcagaatctaaagcactgcgttctattttctttgctactacagaaatgaagaaagaa
aacggcgcagaagctgagccaactgcagtcaacaaagttggcgtgttaggtggcggtcta
atgggggctggcattagccatgtttctgttgcgaaagcgaaagtgccagtacgtattaaa
gatgtcagcaatgatggtgtgcttaacgcgttaaactacaactacaagttgttcgaaaag
cagcgtaagcgccgcattatctcgaaagcgggtctgcaatctaaaatgctgcaactttcg
ggtggtattgattttacaagcttcaatcatattgatgtggttatcgaagctgtatttgaa
gatcttgaccttaaacaggcgatggttgcagatattgaagcgaacgcgaaaccagagact
atctttgcgaccaacacgtcttcgttaccaattcacaaaattgcagaaaaagcagagcgt
ccagaaaacatcgtcggtctgcattacttcagcccagtagagaaaatgccactggtggaa
gtgattcctcatgaaactacgtcagaagagaccatttctaccgttgttgcactagcgaag
aagcagggcaagacaccaatcgtagtgaaagataaagcgggcttctatgtaaaccgcatt
cttgcgccttacatgaacgaagctgcgcacatcttgctggcaaatgagccaatcgaacaa
cttgatggagcgctgcttgacttcggtttcccagtaggtcctatcaccttgttggatgaa
gtcggtgtggatatcggtgctaaaatcatgccgatcttggttaacgaattgggcgagcga
ttcaaaggtccagacgtattcgatacactactgaacgatggccgcaaaggtcgtaagact
ggtaaaggcttctatacctacaaaggtaagaagaaagaagtcgataagtcagtttacaag
ctattgaacctgacgccagaatccaagctaagcgacaatgacattgcactacgttgtgtg
ctaccaatgctaaacgaggcggttcgctgtttagatgacggtattatccgttctccacgc
gatggtgatatcggtgcgatctttggtataggcttcccaccattcttaggtggtccattc
tgttacatggatcaattcggtttgaaagaactggttgagaaaatgaacgagtttgcatcg
aaatacggtgatcgttacgcgccgtgtgatggattactcactcgtgcgggtgaaggtcgt
aacttctacgattaa

DBGET integrated database retrieval system