KEGG   Vibrio campbellii: VIBHAR_03300Help
Entry
VIBHAR_03300      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vha  Vibrio campbellii
Pathway
vha03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:vha00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VIBHAR_03300
Enzymes [BR:vha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     VIBHAR_03300
DNA repair and recombination proteins [BR:vha03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     VIBHAR_03300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Helicase_RecD UvrD_C_2 AAA_11 DUF2075 Viral_helicase1 UvrD-helicase AAA_22 UvrD_C AAA_16 AAA_28 DUF87 T2SSE CbiA TrwB_AAD_bind MukB AAA_29 RNA_helicase ResIII SRP54 NTPase_1
Motif
Other DBs
NCBI-ProteinID: ABU72248
UniProt: A7N1R5
Position
I:complement(3322370..3324547)
Genome map
AA seq 725 aa AA seqDB search
MKTNDLLSEQSSPVATRDLAATPDLLATLESLANKGAIRQLDFQFARFIYSQVEQQENSQ
ELAFIAGVVSSELGKGHICLLLFDGQGQPVDLASKLGLFGESALALNTQLQGVNWVELLQ
ASPLVGAQGEALPMMFDGERLYLHRYWHYEVTLADKLNQLSAAVNLQPQDFTRLSELLNH
LFARQYHFLFNALAKVVEAGTSNQVLPQQLVCDHLDVVTVDSLDWAAIDTAVNQAKQVHD
LQVLDKLVPLSACVNWQKVAAAVALTRRFAVISGGPGTGKTTTVTKLLAALIEQAGQEKN
LTIKLVAPTGKAAARLTESIGKAIQELPVEPELKAKIPTESSTLHRLLGAIPNSAEFRHN
KQNPLHLDILVVDEASMVDLPMMYKVVDSLPKHARLILLGDKDQLASVEAGAVLGDICSF
HAFGFGKEQASAVAKLTGFDTLAYSTNSNASIADSLCMLQKSYRFDARSGIGQLAKAVNA
GSAAKVDDVWSRDFADIEHFALSSQNYNQMMQTLVAEYGRYLKRIGQQEIDQKTGEPETL
THKAKAVLDTFNQCRLLCAIREGDFGVTGLNQRIEKALAARKLIQTQDELWYHGRPVMVT
RNDHGLGLYNGDIGICMRDDSEGEPRLKVFFELPDGSVKSVLPSRVPEHETAYAMTIHKS
QGSEFEYTLMILPPDFSPILTRELIYTGITRAKKRLAMYAEMNVLKRGIKVKTTRASGLV
ERVRN
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaatgatcttctttctgagcaaagcagccctgtggcaacacgagatctagcg
gcaacgccagatctattggcaacgttagaatcgctagcaaataaaggggcgattcgccaa
ttggatttccagttcgcgcgctttatctattcgcaagttgagcaacaagagaacagccaa
gaactggcatttattgctggtgtggtcagcagtgaattaggcaaaggacacatctgtttg
cttctgtttgatggccaagggcaaccagtagatcttgccagtaagctcggtctttttggg
gagtctgcgttagcgcttaatactcaactgcagggcgtcaattgggtggagcttctgcaa
gcgtcgcctttggttggtgctcaaggtgaagccttgccaatgatgtttgatggtgagcgt
ctctacttgcatcgttactggcactatgaagtgacgttggcggacaagctcaatcaactc
agtgcagctgtaaaccttcagcctcaagattttacacgtttgtctgagttgcttaaccat
ttattcgctcgtcagtaccactttctgttcaatgcattagccaaagtggtagaggcagga
accagcaaccaagtgttacctcagcagctagtctgtgaccatttggatgtggttaccgta
gacagcctcgattgggcggccattgatacggcagtcaaccaagcgaaacaagttcacgat
ctacaagtgctggacaagcttgtaccattatcggcttgtgttaactggcagaaggtcgcg
gcagcggtagcactgacgcgtcgttttgcggtgatttccggtggtccgggtacgggtaaa
actactacggtaaccaaactgcttgccgcattgattgagcaagcaggacaagagaaaaac
ctcaccatcaagctggtggcgccaacaggtaaagccgcagcacgtttgacggagtctatt
ggtaaagcgattcaagagttgccagtggagcctgagcttaaagcgaaaattccaaccgag
tcgagcactttgcatcgcctgttgggcgcgatcccgaacagtgcagagtttcgtcacaat
aagcaaaatccgctgcacctcgatattttagtagtggatgaagcctctatggtcgatctg
ccgatgatgtacaaagtcgtcgattcgctaccaaagcatgcgcgtttgattctactggga
gataaagaccagttggcatcggtagaagctggtgcggtgctaggtgatatctgttcgttc
catgcatttggctttggcaaagagcaggcgtctgcggtcgcgaagttgacaggctttgac
actttggcgtacagcaccaatagtaatgcttcgattgccgatagcttatgtatgctgcaa
aagagttaccgattcgatgctcgctctggtatcggccagctagcaaaagcggtcaacgct
ggctcagctgcaaaagtagacgacgtttggagtcgtgattttgctgatatcgagcatttc
gcactgagtagtcaaaattacaatcagatgatgcagactttggttgccgaatatggtcgt
tatttaaaacgcatcggacagcaagagattgaccagaagactggggaaccagaaacgctg
acccacaaagccaaagctgtgctggatacttttaatcaatgccgcttgttgtgtgctatt
cgtgaaggtgattttggtgtgacaggtttaaaccaacgtattgaaaaagcactagcagca
cgtaagctaattcaaacccaagatgaactttggtatcacggcaggccagtgatggtcacg
cgtaacgatcatggcttgggattgtataacggtgatatcggcatttgcatgcgagatgac
agcgaaggcgaaccgcgtctcaaagtgttcttcgaactgccagacggcagcgtgaagtcg
gtgctgccaagccgagtccctgagcatgaaaccgcatatgcgatgaccattcataaatca
cagggcagtgagtttgaatacacgctaatgattttgccgccagatttcagtccaatcctc
actcgcgagctgatctacacaggtattactcgtgcaaagaaacgccttgcgatgtacgcc
gagatgaatgttctcaagcgtggtattaaagtaaaaactactcgagcgagtgggttggtt
gagcgagttagaaattga

DBGET integrated database retrieval system