KEGG   Vibrio campbellii: VIBHAR_03491Help
Entry
VIBHAR_03491      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
vha  Vibrio campbellii
Pathway
vha00620  Pyruvate metabolism
vha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VIBHAR_03491
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vha02000]
    VIBHAR_03491
Enzymes [BR:vha01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     VIBHAR_03491
Transporters [BR:vha02000]
 Other transporters
  Primary active transporters [TC:3]
   VIBHAR_03491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABU72436
UniProt: A7MYU4
Position
I:complement(3546607..3548388)
Genome map
AA seq 593 aa AA seqDB search
MSKPLAITDVVLRDAHQSLFATRMRIEDMLPIAAELDKVGYWSLETWGGATFDACIRFLG
EDPWERLRELKKAMPNTPMQMLLRGQNLLGYRHYADDVVEKFVERAHANGMDVFRIFDAM
NDVRNFQKAVKAAVDVGAHAQGTLSYTTSPVHNTDTWVDLAKHLEDLGCHSLCIKDMSGL
LKPYEAEELITRIKASCDVPLALHCHATTGLSTATAVKAVEAGIDILDTAISSMSCTYGH
TPTETVVAMLQGTERDTNLKLDQIEPIAAYFREVRKKYAKWEGQLKGVDSRILIAQVPGG
MLTNMEGQLKEQGAADRIDEVLEEIPRVREDLGFIPLVTPTSQIVGSQAVINVLTGERYK
SITKETAGVLKGEYGAAPAPVNTALQAKVLDGKEAITCRPADLLEAEMENLTVDLMEKAQ
SEGIKLASERVDDVLTYALFPQVGLKFLKNRGNPDAFEPAPTLEAAKPAAQPVSGGVETY
SVRVDGQVYAVEVGPQGQLTSVTPNTATVPAQPAAPSAPANSAAEAVPAPLAGNIFKVNV
QPGAEVLEGDVLLILEAMKMETEVRAARGGVVQELNVKEGDAVTVGSPLLSLA
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaccactggctatcactgatgtggtccttcgtgacgcccatcaatccctgttt
gctacgcgtatgcgtatcgaagatatgctgcctatcgcagctgagttagataaggttggt
tactggtctttagagacctggggtggcgcaacatttgatgcgtgtatccgtttcttggga
gaagacccatgggagcgcctacgcgaattaaaaaaagcgatgccaaacacaccaatgcaa
atgctactacgtggtcaaaaccttttaggataccgtcattatgctgacgacgtagtagag
aagtttgttgagcgtgctcatgccaatggtatggacgtgttccgcatctttgatgcaatg
aatgacgtacgtaacttccaaaaggcggtaaaagcggcagtagatgtcggtgctcacgca
caaggtaccttgtcttacaccaccagtccggtgcataacacggatacttgggttgatctg
gctaaacaccttgaagatctgggttgccactctctgtgtattaaagacatgtctggccta
cttaagccgtacgaagcagaagagctgatcacgcgcatcaaagcatcttgtgatgtgcct
cttgcgcttcactgccatgcaaccacagggctttctacggcgactgcagtgaaagctgta
gaagcgggtatcgatattcttgatactgcgatttcgtctatgagttgtacatacggccat
acgcctactgagacagtggttgcgatgctgcaaggcacagagcgtgatactaatctgaaa
ctcgaccaaatcgagcctatcgcggcttacttccgtgaagtacgtaagaaatacgccaag
tgggaaggtcagctaaaaggtgtggattcacgcattttgatcgcccaagttccgggtggc
atgttgaccaacatggaaggtcagttaaaagagcaaggtgctgcggatcgtattgatgag
gtattggaagagatccctcgtgttcgtgaagatcttggttttatcccgctggtaacaccg
acgtctcagatcgttggtagtcaagcggtaatcaacgtgctgacaggtgagcgttataag
agcatcaccaaagaaaccgctggtgttttgaagggggaatacggtgcagcgcctgctcct
gttaatacagcacttcaagcgaaagtgttggatggtaaagaagctattacttgtcgtcct
gccgatttacttgaagcagaaatggaaaacctaacggttgatttaatggagaaagcgcaa
tctgaaggtattaagctcgcaagtgaacgtgttgatgatgtgcttacttacgcactgttc
cctcaagtaggcctgaaattcctgaaaaatcgtggtaatcctgatgccttcgaaccagcc
ccaacgctagaagccgcgaagcctgccgcacaacctgtatctggtggcgttgaaacatac
agcgtgcgtgttgatggccaagtgtatgcagtggaggtaggccctcaaggtcaattaact
tctgtgacgccaaatacagcaactgtacctgctcaacctgcagcgccgagcgcacctgca
aatagtgccgctgaagcagtgccagcccctcttgcgggcaacatctttaaagtgaatgtt
caaccgggtgctgaagttttggaaggtgacgttctccttatcttagaagcgatgaagatg
gaaactgaagttcgtgcagcacgtggtggggtagttcaagaactgaacgtgaaagaaggt
gatgccgttacggttggttcgccactgttgagtctagcataa

DBGET integrated database retrieval system