KEGG   Vibrio campbellii: VIBHAR_05253Help
Entry
VIBHAR_05253      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
vha  Vibrio campbellii
Pathway
vha00500  Starch and sucrose metabolism
vha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VIBHAR_05253
Enzymes [BR:vha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VIBHAR_05253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C ADH_zinc_N Cyc-maltodext_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ABU73159
UniProt: A7N642
Position
II:501532..502881
Genome map
AA seq 449 aa AA seqDB search
MSGLQETQSTGANVILHAFDWKYADIAQRAAEISELGYGSVLVSPPMKSAQDERWWQRYQ
PQDYRVIDNALGNTTDFKNMVEALDRVGVLVYADVVFNHMANEAHLRSDLQYPRQAVMDD
YQQNASKYQDLILFGDLSEPLFDENDFVEAFGIKDWKDKWEVQNGRISGGPTDPGLPTLR
VCKHVVEQQRTYLKALKALGVKGFRIDAAKHMTLEHLKLVWTEDITQDVHIFGEIITDGG
ATEEEYELFLEPYLKETRLGAYDFPLFSTIFKAFSKKGSFKSLIDPYCFGQALSNRRAIT
FAITHDIPNNDVFLDLVMDEENEWLAYAYILGRDGGVPLIYTDLDTSGIKGVDGKPRWQN
AWKDARMAKVVAFHNLVHGEPMTVLEGNDDMLVLQRGEKGILVLNKSARAQSLQLTVNKA
LVDMMTGEEVPSGEEIKVAAKSAMLLVEK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcttacaggaaacacaatcaacaggtgcaaatgttatcttgcacgcttttgat
tggaagtatgctgacattgcccaacgcgcagcggagatcagcgagctaggttatggctcg
gtattggtttctccgccgatgaaaagcgcacaagatgaacgctggtggcagcgttaccaa
cctcaagattatcgtgttatcgacaatgcgctcggtaataccacagattttaaaaacatg
gttgaagcactcgaccgtgtaggtgtattggtttacgccgatgtcgtctttaatcacatg
gcgaacgaagcccatctacgctcggatttacaatatccgcgccaagccgtgatggacgat
taccaacaaaatgcaagcaagtatcaagatctgattctattcggtgacttgtcagaaccg
ctgtttgatgagaatgacttcgttgaagcttttggcatcaaagattggaaagacaagtgg
gaagttcaaaatggtcgaatctcaggcggtccaaccgatcctgggttgccgactttacgt
gtatgcaagcatgttgttgagcagcaacgtacttacctgaaagcgcttaaggctctgggc
gtgaaaggtttccgtattgatgccgcaaagcacatgacgttagaacatctaaaattggtt
tggaccgaagacatcactcaagacgtccatatctttggtgaaatcatcacagatggtggc
gcgacagaagaagaatatgagctgttcctagaaccgtatttgaaagaaacacgtttaggt
gcatacgattttccgttgttctctaccatctttaaggcgttctctaagaagggcagtttt
aagtctttgatcgacccgtactgttttggtcaggctttatctaaccgtcgagctattact
ttcgcgattactcatgatattccaaacaatgatgtgttcttggatttagtcatggatgaa
gagaacgaatggctagcgtatgcctacattctgggacgcgatggcggtgttccgcttatt
tacacggatttggacaccagtggtatcaagggcgtggacggtaaaccaagatggcagaat
gcgtggaaggacgcacgtatggcaaaggtggtggcattccataatcttgttcatggcgag
ccaatgacggtactagaaggtaacgacgacatgttggtacttcagcgcggcgagaagggc
atcttggtactcaacaaatctgcgcgagcgcaatcactgcagctgacagtgaacaaggct
ctggttgatatgatgaccggagaagaagtgcctagcggtgaagagattaaagtggcggcg
aaatcagcaatgctgcttgtagaaaagtaa

DBGET integrated database retrieval system