KEGG   Vibrio campbellii: VIBHAR_05668Help
Entry
VIBHAR_05668      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
vha  Vibrio campbellii
Pathway
vha00260  Glycine, serine and threonine metabolism
vha01100  Metabolic pathways
vha01110  Biosynthesis of secondary metabolites
vha01120  Microbial metabolism in diverse environments
vha01130  Biosynthesis of antibiotics
vha01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VIBHAR_05668
Enzymes [BR:vha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     VIBHAR_05668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ABU73570
UniProt: A7N8A5
Position
II:complement(877699..878703)
Genome map
AA seq 334 aa AA seqDB search
MDFRSDTVTQPTQAMREAMFNAPVGDDVYGDDPSVNELEQFAAELAGFEAALFTSSGTQA
NLLGLMAHCERGDEYLCGQQAHNYKYEAGGAAVLGSIQPQPIENNPDGTLPFDKLEAAIK
PDDAHFARTRLLSLENTINGKVIPLSYLAQAREFVNKHNLQMHLDGARVFNAAVALDVPV
KEIGQYFDSMTICLSKGLAAPIGSLLLGNKEYIAKARRLRKMVGGGMRQAGILAAAGKLA
LTEQVEQLKQDHINAKTLAEGLAELPGFSVNPEFVQTNIVFAKLDPQVDIAGIAEKMKEQ
GITITPGNPIRFVTHKDISAQDIDTFLSSLKSML
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggactttcgatcagatactgttacgcaacctacccaagccatgcgtgaagccatgttt
aacgcgcctgtcggagacgatgtttacggtgacgacccaagcgttaacgagttagaacaa
tttgctgctgagctcgctgggtttgaagctgcgttattcacttcatctggcacgcaggca
aacctacttgggttaatggcacattgcgaacgcggtgatgaatacctgtgtggccagcaa
gcacacaactataaatacgaagctggtggtgctgcggtactgggctctattcagcctcaa
ccgattgaaaacaacccagacggcactttgccatttgataaactagaagccgcgattaaa
cctgatgatgcgcactttgcacgtactcgactacttagcctagagaacaccatcaacggt
aaagtgattcctctctcttaccttgcacaagcacgtgagttcgtgaacaagcacaatttg
cagatgcacctagatggcgctcgtgtattcaacgcagccgttgcacttgatgttccggtt
aaagagattggtcaatactttgattcaatgacaatctgtctgtcgaaagggctcgctgct
cctattggctcattattactgggtaataaagaatacatcgctaaagcgcgtcgcttgaga
aagatggtcggcggaggcatgcgtcaagcgggtattcttgctgcagctggtaaactagcc
cttaccgagcaagtggaacaactaaaacaagaccacatcaatgcaaagacattagcggaa
ggtttagcggaattgcctggtttctctgttaatccagaatttgttcaaaccaacatcgtt
tttgccaaacttgatccacaagtggatatcgctggtattgcagaaaagatgaaagagcaa
ggcatcacgattactccaggaaacccaatccgcttcgtgacgcataaagatatttcggca
caagacatcgatactttcctatctagccttaaatctatgctttaa

DBGET integrated database retrieval system