KEGG   Vibrio campbellii: VIBHAR_05856
Entry
VIBHAR_05856      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
vha  Vibrio campbellii
Brite
KEGG Orthology (KO) [BR:vha00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vha02044]
    VIBHAR_05856
Secretion system [BR:vha02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VIBHAR_05856
SSDB
Motif
Pfam: ImpA_N PriA_C
Other DBs
NCBI-ProteinID: ABU73750
UniProt: A7N2A7
Position
II:1041040..1042344
AA seq 434 aa
MFFSDFARRPIDESNPSGSNPNGLDDFDEIKRQINNLNKVTGRVSWKTIQTLSKKILSTQ
GKDFRCSCYFTVAATHNDGLKGLVEGLNSLLDLCVVYWYTAYPEHAKANARISAIEWMVE
YTEKRIKKHRALPEELPLIEAAHQLCLRIEEELRLHYGIKAPSFGRIRRILNQWIEEIKE
TKAKEAKALEVKQEKPETPSNPGGIQVNIAPPPKTETKPTPQPQVKEAPKSSRAVVFSVI
GLLVVAFASHFVYKQHKYQTLKDDIEHSSLKQLAAIVDSLSVENKEHRIALRSATVERLD
ALMTDWAIDPVKVSEVNTIDELTSELTEIYPDSSSAQQLRENFLDQRSRFENEFDVIYKR
FAYARTVFANVAKQNTDRDSKKAYEYSNSLFPLLGRIEYAEKNAQQKEIERSLLLLNAYL
YKINQLQTATNDNK
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgtttttcagcgacttcgctagaaggccgatcgatgaaagtaatccaagcggctcaaac
cctaatggcttagatgattttgacgaaattaagcgccagataaataacctgaataaagtg
actggtcgagtatcatggaaaacgattcaaacactttctaagaaaattcttagtactcag
gggaaagattttcgttgtagttgctactttaccgtggcggctacgcacaacgatggcttg
aaaggcttggttgaaggcttgaactcactgctcgacttatgtgttgtgtattggtacacc
gcctacccagagcacgcgaaggccaatgcacgtatcagtgccatcgagtggatggtcgaa
tacactgagaagcgaattaaaaagcatcgagccttaccagaagagctcccgcttattgaa
gcggcgcatcaactgtgtttacgcatcgaagaagaactgcgcctacattatgggattaaa
gcgccatcattcggtcgcattcgtcgtatattgaaccaatggattgaagagattaaagaa
acaaaagcaaaggaagctaaagcattagaagtcaaacaagagaagccagaaacaccatcg
aatccaggtggcatccaagtcaatattgcgccgccaccaaaaacggaaaccaagccgacg
cctcagccgcaagtaaaagaagcgcctaagtccagccgcgcggttgtattttctgttatt
ggattgcttgtcgttgcatttgcttcccactttgtttacaagcagcacaaataccagact
ctgaaagatgacattgaacactcgtcactaaaacagctagcagcaatcgtcgattcattg
agcgttgagaacaaagaacaccgcatcgctttacgttctgcgacggtcgaacgccttgat
gcattaatgaccgattgggcaatcgatcctgtaaaagtcagcgaagtgaataccattgat
gagcttactagtgaattgacggagatctacccagattcatcatctgctcagcaacttcga
gagaattttttagaccaacgttctcgtttcgaaaatgaattcgatgtcatatacaaacgc
tttgcttatgctaggacggtatttgccaacgtagcgaaacagaacaccgacagggactcg
aagaaagcgtatgaatacagcaattcgctgttcccgcttcttgggcggattgagtacgca
gaaaagaatgcgcagcaaaaggaaattgaacgctccctccttttactgaacgcctaccta
tataagattaatcagttgcaaactgcaacaaacgacaataaataa

DBGET integrated database retrieval system