KEGG   Vibrio campbellii: VIBHAR_05857Help
Entry
VIBHAR_05857      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
vha  Vibrio campbellii
Pathway
vha03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vha00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VIBHAR_05857
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vha02044]
    VIBHAR_05857
Secretion system [BR:vha02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VIBHAR_05857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF_C IcmF-related CWC25
Motif
Other DBs
NCBI-ProteinID: ABU73751
UniProt: A7N2A8
Position
II:1042372..1045761
Genome map
AA seq 1129 aa AA seqDB search
MFKQKILRNPILVSTIVALLLAAIFAAVYLFLLEDADKLYLWIGLGVISAFYLIFQLSLW
FKKKNNSKAQRLETEEEALSMVIRPLLSHSGKKPIYLMIGNKGSGRRQFLFNSSAIKPMD
RSRTAKNDFFEWYESDGAVYVKPDQRLVFQEVSSSDASLWNTFVDEVIRHRPRKPFSGCL
FFTDFEFMIVSEPEQKDYTITALLQRLSSISEKTSSALPVYLMMSKLDKLDGFKEYVHFS
SLKTRVEFLSIPLKEAKGVITEYYRDGYRNLVKVLESNALDASANSTDIDEKQAILSFPK
QFELCQAEISYVLERLCDVNSGTYSLDIREIFFCSSLQGGRKYNLLAKSCSNYFNLPIIA
SEHTQLTETPYFSRFLIDSQILPESDFAGENKTYLRLIQRQSHLAMLASVILLAGGTYFF
VTTLDSNLRVINQLLGIDDNGQVEQEASFNQLLVNATRAIQPSYSAWLEGSRALDEEVLP
LNISRLDQSTRLAYEALLKEVAQQLMPVVEKGYRLELTHNQHDVAATLPLLKGYLMLNDR
SKRDIQFLRRQTLQTLNDLSDKPDVVNQAMRYLDAYFRTQFAPVDINMDIVRATRRSLLA
NSNVDLVYAGILNQADAIDLGTLDLQRAVGFEFNNVFNEPLDDNRLVIDKVYTSTGFSTF
YRPRVDLMSQQVISDNWVLGLSNHVIPTKQEQDAFKTQVRKKYTDDYINYWRNALSELRV
QHYSNVGDLTNAIDLISGPSSPMTTVLKQVYANTQFSPVGEKNALIANVNPKLAEVADTA
SEAVEEAVQPDYLLMKRVEQAFHLLNQLQVSETPNSPTPWDETIAALSRVRTYMKDIADA
PDPQMAALAAAQHRMNSTEADPLIKLKQIAQKSPEPVRNWLLDVVQQSWSVMIAESAKGI
QTQWYSEIYTKFKELGLGKYPFDLNATEEISIEDFELLFASGGLLDTFIQKNFAPFYDTN
LWTPKQVDGETMPLSPALLVQLRNYNVIRDTLINKSTNRVYIPFSAKVLDLDSSAIRATL
KISDTDINYYHGPSRIREMEWPPQNGDFNISITIQDVTDEGKQHVLNKSGQWAIYRLLGD
STLTNTHNGSFVSDIKVSGRDLSLRITPLTQKNPFTLAELYNFTLPESI
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacaaaaaatactaagaaacccgattttggtttctaccatagtggctttgcta
ttagccgcgatatttgcagcagtgtatttattcttacttgaagatgcagataagctatat
ctatggattggccttggcgtcatttctgcattttatcttatattccagttgtcactatgg
tttaagaaaaagaacaactcgaaagcccaacgtttggaaaccgaggaagaagccctttct
atggttatccgccctcttctttctcattcaggcaagaaaccaatctacctaatgattggt
aataaggggtctggccgacgtcaatttttgtttaattcaagcgcaattaaaccaatggat
cgttctcgcactgcaaaaaacgatttctttgaatggtatgaatctgacggtgcggtttat
gtaaaaccagaccaacgcctcgtattccaagaagtatccagtagtgatgcttcattgtgg
aacacgtttgttgatgaggttattcgtcaccgtccaagaaaaccgttttctggctgttta
ttttttactgactttgagttcatgatcgtctcagaaccagagcaaaaagattacaccatt
accgcactattgcagcgcctaagttctattagcgaaaaaacatcatcggcactaccagtt
tatttgatgatgtctaagcttgataagttggacggtttcaaagagtacgtacatttcagt
tctctgaaaactcgtgtggaattcctttctattcctcttaaagaagcgaaaggcgtcatc
actgaatactaccgagatggttaccgtaatctggtgaaagtactggaaagcaatgctctg
gacgcttctgcaaattcgacagacatcgatgaaaaacaagctattctgtcattcccgaaa
cagttcgagctttgccaagcagaaatcagttacgtccttgagcgtctttgcgatgtgaac
agcggcacttattcgctcgacattcgtgagatctttttctgctctagcttacaaggtggt
cgtaagtacaacctgttagcaaaaagctgcagcaattactttaatttgccgatcattgct
tcagagcacacacagctgacagaaacgccttacttctctcgcttcctgattgactctcag
attttgcctgagagcgattttgcgggtgaaaacaaaacgtatttacgcttaatccaacgt
caaagtcatttggccatgttagcgtccgtgatcttgttggctggcggtacctacttcttt
gttaccacactagacagtaacttgcgtgtgattaaccaattgcttggtattgatgacaac
ggtcaggttgaacaagaagcaagcttcaatcagcttctcgtaaacgccactcgcgctatt
caaccttcgtacagtgcatggctagaaggctctcgagctctagatgaagaagtgcttcca
ctgaacattagccgcttggaccaaagcacacgtctggcttacgaagcactgcttaaagaa
gtggcacaacagcttatgcccgtcgttgaaaaaggctaccgtctagagttgacgcataac
caacatgacgttgccgcgacactgccattgctaaaaggctacttgatgctgaacgatcgc
tcaaagcgtgacattcagttcctacgtcgccagaccttgcaaacccttaatgatttaagc
gataagccggatgtagtaaaccaggcaatgcgctatttagacgcttatttccgtactcag
tttgcgcctgttgatatcaatatggacattgttcgtgccactcgccgttctttactggcg
aactctaacgtcgaccttgtttatgcgggtattttgaatcaagccgatgctatcgacctt
ggtacgctagatcttcaacgcgctgttggctttgagttcaacaacgtgtttaatgaaccg
ctagacgacaaccgcttagtgattgacaaagtctacacgtctactggctttagcaccttc
tatcgccctcgtgtggacctgatgtcacagcaagttatcagcgataactgggttcttggc
ttgtctaatcacgtgatccctacgaaacaagagcaggatgcgtttaagacacaggtacgt
aagaaatacaccgatgactacatcaactactggcgtaatgcactgagtgaactgagagta
cagcattacagcaatgtgggcgacttgacgaatgcaatcgaccttatttctggtccgtct
tctccaatgacgactgtattaaaacaagtgtacgcgaacacccagttttctccggttggt
gaaaagaatgcattaattgccaatgtaaaccctaagctagcggaagttgcagatacggcc
tcagaagcagtagaagaagccgtacagccagattacttactgatgaagcgtgttgagcaa
gccttccacttgttaaaccaacttcaagtcagtgagacacctaactccccgactccatgg
gatgaaaccattgcagcattaagccgtgttcgtacttacatgaaagacatcgctgatgca
ccagatccacaaatggccgcacttgcagcagcgcaacaccgcatgaacagtacagaagcg
gatccgcttatcaaactgaagcagatcgcgcagaagtctccagagccagtgcgtaactgg
ttacttgatgtggtacagcaaagctggtcagtgatgattgctgagtccgcaaaaggcatt
caaacccaatggtacagcgagatttacaccaagtttaaagagctagggcttggtaaatac
ccatttgatctgaacgcgacagaagagatttcaattgaagacttcgagctgttgttcgca
tcaggtggtttgttagatacgtttattcagaagaacttcgcaccgttctacgatacaaac
ttgtggacaccaaagcaggtggatggcgagacaatgcctctttcgcctgccctattggtg
caattgcgcaattacaacgttatccgcgatacgttgatcaacaagagcacaaaccgagtt
tatatcccgttcagcgcgaaagtattagaccttgattccagtgctatccgagccactctg
aaaatttcagacacggatatcaactactatcatggtccgagccgaattcgtgagatggag
tggccgccgcagaacggtgacttcaacattagtatcacgatccaagatgtgacagacgag
ggcaagcagcacgttcttaataagagtggtcagtgggcgatatacagattgctaggtgat
tcgaccctgacaaacactcataacggtagcttcgtcagtgacataaaagtgtctggaagg
gacttaagccttcgtatcactcctttgacacagaaaaaccccttcactcttgctgagctg
tataactttacactccctgagtcgatttaa

DBGET integrated database retrieval system