KEGG   Vibrio campbellii: VIBHAR_05863
Entry
VIBHAR_05863      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
vha  Vibrio campbellii
Brite
KEGG Orthology (KO) [BR:vha00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vha02044]
    VIBHAR_05863
Secretion system [BR:vha02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VIBHAR_05863
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABU73757
UniProt: A7N4P4
Position
II:complement(1051056..1051562)
AA seq 168 aa
MSRDGSVAPKERINIRYVPATGDTQDDVELPLSMMVVGDFTARADETPIEERTPINIDKD
NFNEVLEGMSPNVKVNVENRLSDEEGGQIGVDLTFQNMKDFSPEAIAKSVPELNSLLELR
EALVALKGPLGNVPAFRKKIASVLQDEEARKKLLDELSIGDDQEAKEE
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtcacgtgacggctcggtggctcctaaagagcgaattaatatccgttatgttccagca
actggtgatacgcaagacgacgtagaactgccgctgagcatgatggtggttggtgacttt
actgcacgtgcagatgagacgcctatcgaagaacgtactccaatcaatatcgacaaagac
aactttaacgaagtgctagaaggcatgtctccaaacgttaaagtgaacgttgaaaaccgc
ctttctgacgaagaaggcggccaaatcggtgttgatctaacgttccaaaacatgaaggac
ttctctcctgaagcgatcgcgaaaagcgtacctgagctaaacagcttgcttgagcttcgc
gaagcgttggttgcactgaaaggccctctaggtaacgttcctgcgttccgtaagaagatc
gcatcggttcttcaagacgaagaagcgagaaagaaactgttggatgaactaagcattggc
gacgaccaagaagcgaaagaagagtaa

DBGET integrated database retrieval system