KEGG   Vibrio campbellii: VIBHAR_05877Help
Entry
VIBHAR_05877      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
Organism
vha  Vibrio campbellii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABU73771
UniProt: A7N4P2
Position
II:complement(1072915..1074612)
Genome map
AA seq 565 aa AA seqDB search
MHLVCKFIPSSKLSSNELSYVLTPDECIGQLSRVRNSENILRNLPKELAQKISISAKKSS
AGLLTAIRNELGNGNWVALSSFSRRTPLTDAQLQSFPRLKAQLESVSSTGESKVYKAGYK
QVTDDVTLVRSYAHVPYEPSPEHKIVVEFAGQWSSNAACLMLGKTDAQKEKVTVSKADTE
NKHRSLATFKDLDAEGKTLYIKIPCSDQPQPILLKLAEDLQPVDKETQMDEWDNVLVPVR
PLAYLDGSNDKAKASDLRGGFLYVFWKGKLWREMAINEKGYYQDVDVEYYRTLEQEEKKK
DTPQVIQRSASGFAMAHFWAPYKISGEVQQGENGLKFIFSPKQKRFAQIEALESDAALLE
KSSTPLDELSSYSDAQSFSSQEFTSDVDSAAIHKVTEDDMPWLSDQQAIVRSYDQSNTVI
AYVDGKNSGFLVRLEVGLADGPLAEQLDPYSLASYDGLVAIMEDSESDWRVTEPFELISK
DGYISALVTGMPPKGKFTLVLSHLGGQDSEVMMFEGLTYQEITAEPPELPMASKHEEQRV
PDEVNEERERQKKTLDMMLELINAN
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgcatttagtttgcaaatttatacctagctcgaagctttcctccaacgagctatcctac
gtccttacacctgatgaatgtatagggcagctttcgcgtgtgcgaaattcagaaaatatt
ctcagaaacctgcctaaagagcttgctcagaagatctcaatctctgccaaaaagtctagc
gccggcttgctaacggctattcgaaatgagctaggaaatggtaactgggtggcgttgtct
tccttctctcgtagaacgccgttaacggatgctcaattacaaagtttcccaagactaaaa
gcacagcttgaatctgtctcatcgactggtgagagtaaagtttataaagcaggttataag
caggtaacggacgatgtgacattggttcgcagttacgcgcatgtgccttatgaaccaagt
ccagaacataaaatcgttgtcgagtttgctgggcagtggtctagcaatgcagcctgtttg
atgttgggaaaaaccgacgcacaaaaagaaaaagtgactgtaagtaaggctgataccgag
aacaaacaccgcagccttgccacgtttaaagatctggatgctgaaggcaaaacgctttat
atcaaaatcccttgttccgaccagcctcagccaatcttgcttaaactcgctgaagacctg
caaccagtcgataaagaaactcagatggatgagtgggataacgtgttggtgccggtcaga
cctttggcttacttagatggtagcaacgacaaagcaaaagcttctgacctgcgtggtggt
ttcctttatgtgttttggaaaggaaagctttggcgagagatggcgataaacgagaaaggt
tactaccaagatgttgacgtcgagtattaccgcacgctagagcaagaagaaaagaaaaaa
gacacacctcaggtaatacaaagaagcgcaagcggttttgctatggcgcatttctgggca
ccttacaaaatatcgggtgaagtccaacagggagaaaatggactcaagttcattttctca
ccaaagcaaaagcgctttgctcaaattgaagcattagaatcagatgctgctttgcttgag
aaatccagcacaccattagatgaattaagcagttacagtgacgcacagtcattcagttca
caagaattcacctccgatgtagacagtgccgccatccacaaagttaccgaagacgacatg
ccatggctgagtgaccaacaagccatcgttcgcagttatgaccagagtaatacggtcatt
gcttatgtggatggcaaaaacagtggttttcttgtccgtttggaagttggcttggcagat
ggcccattggcagaacagctagacccttactcgttggcttcgtatgacggcttggttgcc
attatggaggattctgaaagtgactggcgagtgaccgagccctttgagttaatcagtaag
gatggttatatcagtgccttagtgacaggtatgcctcccaaaggaaagtttacacttgtg
ctttcgcaccttggggggcaagacagcgaggtgatgatgtttgaagggctgacgtaccaa
gagatcaccgcagaaccaccagaattaccgatggcttctaagcacgaagaacagcgagtg
cctgatgaagttaatgaagaaagagagcgtcaaaagaagacattagacatgatgctagag
cttatcaacgccaattaa

DBGET integrated database retrieval system