KEGG   Vibrio campbellii: VIBHAR_06345Help
Entry
VIBHAR_06345      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
vha  Vibrio campbellii
Pathway
vha00511  Other glycan degradation
vha00520  Amino sugar and nucleotide sugar metabolism
vha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VIBHAR_06345
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VIBHAR_06345
Enzymes [BR:vha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VIBHAR_06345
Chaperones and folding catalysts [BR:vha03110]
 Intramolecular chaperones
  Others
   VIBHAR_06345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2 NigD_N
Motif
Other DBs
NCBI-ProteinID: ABU74236
UniProt: A7N8P3
Position
II:complement(1512084..1514420)
Genome map
AA seq 778 aa AA seqDB search
MGQGKITLDKSFSIYIKGYDSPRVQFNAKRTMDRLYRQTGLPMLNWHAESEKDATLVIDI
RNAPKSEVQDIHSEKSYQLESRNGQIIIRSERPYGAFHGLETFLQLVTTDVTGYFVPAVL
IQDEPRFPWRGVSYDTSRHFIELDVILRQLDAMASAKMNVFHWHIWDDQAIRIQLDNYQK
LWQDTADGDYYTKDEIRHVVNYARNLGIRVIPEISLPGHASAVAHAYPELMSGMGEQSYP
HQRVWGVFEPLMDPTNPELYKMLASVFDEVVELFPDEYFHIGGDEPNYQQWKDNPKIQQF
IKDNNLDGERGLQSYLNTKVEQMLEQRDKKMTGWDEIWHKDLPTSIVIQSWQGHDSIGRA
AKEGYQGILSTGYYLDQPQPTSYHYRNDPMPKGITIDDQLHQGEKFATYDWVKPRNKGGP
RTGNLTIIEATDGSYRAFTDYNGKSREEVFIIEYVPGVKFKGHFDNFMSYTEFNYDFADG
KLKDTSYQLIGNVRWPATGELVASSDMAGGVIPEPKGGYPAELTEKEQLLILGGEITIWG
ENLDSMTIEQRLWPRSYAIAERLWSSQELTDERSMYKRMTVMDTWSEISLGLRHYADSNM
MLKRLANGADETPLLTLAKYIEPAQYYSRHWEKWISTPNEGDLYNQYERLNRFADALPVE
SLAVYEMKDLVAAYAQGDKAALDALAMHYQSVKLAAQQAKPIFAANVASVETVPVADAAI
KVADLGLTWIELAKQGSDISQSDAEAYQRIINENAIIFDETIVAILVPTEQLLHTLTD
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
gtggggcagggtaaaatcacactggataaatccttcagcatttacatcaaaggctacgat
tcaccgcgcgtgcagttcaacgccaagcgcaccatggatcgtctatatcgccaaaccggc
ttaccaatgttgaactggcatgctgagtcggaaaaagacgcgactctggtgattgatatt
cgtaatgcgcctaagtccgaggtgcaagacattcacagtgagaaatcgtatcaacttgag
tcgcgtaatggtcagatcattattcgctccgaacgcccttacggtgctttccatggttta
gaaaccttcttgcagttggtgactacggacgtgactggctactttgtgcctgcggtgttg
attcaagatgagccacgttttccttggcgtggcgtttcttacgatacttcccgccacttt
atcgaactcgatgtaatccttcgccaactcgatgcgatggcatcagcaaaaatgaacgtt
ttccattggcatatttgggatgaccaagcgatccgtatccagctcgataattaccaaaag
ctgtggcaagacaccgcagatggtgattattacaccaaagatgaaattcgccatgtagtg
aattacgcgcgtaaccttggcattcgagttatccctgaaatctctttgccgggacatgct
tcggcagtagcgcatgcttaccctgaattaatgtctggcatgggtgagcagtcttatccg
catcaacgtgtctggggtgtgtttgagccgttaatggacccgaccaatcccgaactctat
aagatgctggcgagtgtgtttgacgaagtggttgagctctttccagatgagtacttccat
atcggcggggatgaaccaaattaccaacagtggaaagacaacccgaagattcagcaattc
atcaaagacaacaatctggatggtgagcgcggtctgcaatcgtatctgaacaccaaggtt
gaacagatgctggaacagcgcgacaagaagatgactggctgggatgaaatctggcacaaa
gaccttccaacctcgattgtgattcaaagttggcaagggcatgacagtatcggtcgagca
gcaaaagagggctaccaaggcattctctcaacaggctactacctagaccagccacagcca
accagttaccactaccgcaatgatccaatgccgaaaggcatcacgattgatgaccaactt
catcaaggtgagaaattcgcgacttatgattgggtgaaaccacgcaacaaaggtggtcca
cgtacaggtaatctaaccattattgaagcgacagacggcagctaccgtgcgtttaccgat
tacaacggcaagtctcgcgaagaagtgttcatcatcgagtatgtgccaggtgtgaagttt
aaaggccacttcgataactttatgtcttacaccgaattcaactatgactttgcagacggc
aagttgaaagacaccagttaccaattgattggcaatgttcgttggcctgcgactggagaa
ttggtcgcgagcagtgacatggcaggaggcgtcattcctgagccgaaaggtggttatccg
gctgagttgaccgagaaagaacagctgctaatcttaggtggagaaatcacaatttggggt
gagaacctcgattcaatgaccatcgagcaacgcttatggccacgaagttacgcgattgct
gagcgtctatggtcgagtcaggagctaaccgatgagcgcagcatgtacaagcgcatgacg
gtgatggatacatggtctgagatttcgcttggtctacgccattacgccgattccaatatg
atgctaaaacgtcttgccaatggtgcggacgaaacgccgctactaacgttagcgaagtac
atcgagccggctcaatattactctcgtcattgggagaagtggatttctacgccaaacgaa
ggcgatttatacaatcagtatgagcgattaaaccgctttgcggatgcactgccagtagaa
agccttgcagtgtacgagatgaaagatttggtcgcagcttatgctcaaggtgataaagct
gcgttggatgcgctagcgatgcattatcagagcgttaagttagcggcgcagcaagccaaa
cctattttcgcggccaacgtagcgtcggtagaaacggtgccagttgcagatgccgcaatc
aaagttgccgatttaggtttaacctggattgagctcgccaagcagggcagtgacattagc
caatctgacgctgaagcgtatcaacgcatcatcaatgaaaatgcgattatttttgatgaa
acgattgtcgccatcttagtaccaaccgagcagttgcttcacactttaaccgattga

DBGET integrated database retrieval system