KEGG   Vibrio campbellii ATCC BAA-1116: VIBHAR_p08214
Entry
VIBHAR_p08214     CDS       T00589                                 
Name
(GenBank) hypothetical protein
  KO
K03198  type IV secretion system protein VirB3
Organism
vha  Vibrio campbellii ATCC BAA-1116
Pathway
vha03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vha00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VIBHAR_p08214
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vha02044]
    VIBHAR_p08214
Secretion system [BR:vha02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   VIBHAR_p08214
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: ABU75061
UniProt: A7N8U6
Position
pVIBHAR:complement(42685..43056)
AA seq 123 aa
MQDEERDQYASYNSLARKPLMFGMPIIPLITGMLLMLLTGWLGLSFFGVKGLVFPAFIAL
GLLYIRVRSEEDSRAIDEMKWEAKGFLTRLRCQSNTISFTSIDNHPFRRKQHVSEWFKNN
TPD
NT seq 372 nt   +upstreamnt  +downstreamnt
atgcaagacgaagaacgagatcaatacgccagttataactcactggctcgcaaaccactc
atgtttggcatgcctatcatccctctcattacagggatgttgttgatgctactgactggt
tggcttgggctgagtttcttcggagtaaaagggctggtttttccagcctttattgcttta
gggctactgtatatccgcgttcgtagcgaggaagacagccgagccatcgatgaaatgaaa
tgggaggcaaaaggcttcttaactcgccttcgctgccagtccaacaccatttcattcact
tctatcgataatcacccattcaggagaaagcaacatgtcagcgaatggtttaaaaacaat
acccctgactga

DBGET integrated database retrieval system