KEGG   Virgibacillus halodenitrificans: BME96_05305Help
Entry
BME96_05305       CDS       T04548                                 

Definition
(GenBank) alcohol dehydrogenase AdhP
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
vhl  Virgibacillus halodenitrificans
Pathway
vhl00010  Glycolysis / Gluconeogenesis
vhl00071  Fatty acid degradation
vhl00350  Tyrosine metabolism
vhl00625  Chloroalkane and chloroalkene degradation
vhl00626  Naphthalene degradation
vhl01100  Metabolic pathways
vhl01110  Biosynthesis of secondary metabolites
vhl01120  Microbial metabolism in diverse environments
vhl01130  Biosynthesis of antibiotics
vhl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vhl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BME96_05305
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BME96_05305
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BME96_05305
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BME96_05305
   00626 Naphthalene degradation
    BME96_05305
Enzymes [BR:vhl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BME96_05305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_31 Methyltransf_25 TrkA_N ADH_N_2 2-Hacid_dh_C zf-CXXC
Motif
Other DBs
NCBI-ProteinID: APC47618
UniProt: A0A1J0GZE5
Position
complement(1040648..1041670)
Genome map
AA seq 340 aa AA seqDB search
MKAAVVSAKNKGRLEIKEIELPKLAPGQALVDVEYCGVCHTDLHVAKGDFGEVPGRVPGH
EGIGIVKEVADDVTSIKVGDRVSIAWFYKGCGTCEYCLTGRETFCRDVKNAGFTVDGAMA
EQCIVEADYAVKVPEGLDPAQASSITCAGVTCYKAIKVADIKPGQWIAIYGCGGLGNLAI
QYAKNVFNAKVIAVDINDDKLELAKEIGSDLVCNPLTDGDAGDWIQEKVGGAHAAVVTAV
SKVAFNQAVNSVRATSKVVAVGLPPETMDLEIVKTVLDGIQVVGSLVGTRKDLQEAFQFG
AEGKVVPIVETRCLHEVNDIFEEMEQGKIQGRMVIDMHKK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtagtgagtgctaaaaacaaaggtcggttggaaattaaggaaattgaa
ttaccgaagctagcaccagggcaagcccttgtagatgtagaatactgtggtgtgtgtcat
actgacttacacgttgcgaaaggcgattttggagaagttcccggacgtgtaccaggccac
gaaggtattggtattgttaaagaagttgcagatgatgtaacaagcattaaagtaggcgac
cgggtcagtattgcttggttttataaaggatgcggaacatgtgagtattgtttaactggt
cgagaaacattttgtagagatgttaaaaatgccggctttactgtcgacggagccatggct
gaacaatgtattgtcgaggctgattatgctgtaaaagttccagaaggattggaccctgcg
caagcaagtagtataacttgtgctggtgttacttgctataaagcaattaaggttgctgat
ataaaaccaggtcaatggattgcgatctatggttgtggtggtttaggaaacctagcgatc
cagtatgctaaaaatgtatttaacgcaaaggtaattgctgttgatattaatgatgataag
ttagagttagctaaagaaataggttcagatcttgtttgcaatccgcttacagatggagat
gcaggtgattggattcaggaaaaagtcggtggagcacatgctgcagttgtaaccgccgtt
tccaaggttgcttttaaccaagctgttaattctgtccgtgctacatccaaagtggttgcc
gtaggtcttccacctgaaacaatggacttggaaattgtaaagacggtattagatggtatc
caggtagtaggatctcttgtagggacaagaaaggatttgcaagaagcattccaatttggg
gctgaagggaaggtcgttcctattgtagaaaccagatgcctgcatgaggttaatgatatt
tttgaagaaatggaacaaggtaaaattcaaggaagaatggttattgatatgcacaagaaa
taa

DBGET integrated database retrieval system