KEGG   Virgibacillus halodenitrificans: BME96_09990Help
Entry
BME96_09990       CDS       T04548                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
vhl  Virgibacillus halodenitrificans
Pathway
vhl00670  One carbon pool by folate
vhl01100  Metabolic pathways
vhl01120  Microbial metabolism in diverse environments
vhl01200  Carbon metabolism
Module
vhl_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:vhl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BME96_09990
Enzymes [BR:vhl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     BME96_09990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: APC48482
UniProt: A0A1J0H1W2
Position
1917791..1919461
Genome map
AA seq 556 aa AA seqDB search
MKSDIEIAQEATLKPINTIATDLGLDLDDWEPYGHTKAKLSEHLLDKLKDRPEGKVILVT
SINPTPAGEGKSTVTVGLGQALNRIGKKSVIALREPSLGPVMGIKGGAAGGGFSQILPME
DINLHFTGDLHAITTANNALSAIIDNHIHRGNELNIDPRRIEWKRVMDMNDRVLRQIVVG
LGGPLRGVPREDGFNISVASEIMAVLCLSTSINDLKARLSRMVVGYTYDEQPITVKDLKV
EGALTLLLKEAIKPNLVQTIENTPAIVHGGPFANIAHGCNSVLATKTAAKLGEYVVTEGG
FGADLGAEKFLDIKTRAGDIDTAAVVIVATVRALKMHGGMAKAELKQENVEALKAGMENL
KKHIETIETFGLPFVVAINKFPSDTKAETDFISNWCESRGFEVALTDVFAHGGEGGIELA
QKVVEKANTSDKNFKRIYELDESLETKIRKVAQQVYGADDIELSPKAKKQITLYEELGWG
KLAICMAKTQYSLSDDPTLLGRPRDFTINIRELRPSIGAGFIVVLTGDVMTMPGLPKEPA
ALKMDVSEDGKAVGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctgatatagaaattgcacaggaagccacactgaaaccaatcaatacaatcgct
acagacctaggtttagatttagacgattgggaaccatatggtcatacaaaagctaagctc
tctgagcacttattagataaattaaaagatagaccagaaggaaaagtaattctagttact
tcgataaatcctacaccagcgggtgaagggaaatctacagttactgtaggtttaggacaa
gcattaaatagaattggaaaaaaatcagttattgctttaagagaaccttcacttggtccg
gtaatgggaataaaaggaggagcagcaggtgggggattctcacagattttgccgatggag
gatatcaacttgcattttactggggatcttcatgctattactactgctaataatgctctg
tctgctatcattgataatcatattcacagaggtaatgaattgaatattgacccacgtaga
attgaatggaaacgcgttatggatatgaacgatcgggttctaagacaaatagtagtaggt
cttggcgggccattacgcggagtgccaagagaagacggctttaatatatctgtagcatct
gaaattatggcagttctttgtctgtctacttcaatcaatgatttgaaagcccggctttcg
agaatggtggtaggctatacatatgacgagcaaccaattacggttaaggatctaaaggta
gaaggcgcattaacattactacttaaagaggcaattaagccaaatcttgtccaaacaata
gagaacactccagccattgtacatggaggtccatttgccaacatagcccatggttgtaat
agtgtgctcgcaacaaaaacagccgctaagcttggtgaatatgttgtcactgaaggagga
tttggcgctgatttaggtgcagaaaagttcttagatattaagactagggctggagatatt
gatactgcggcagtagttatagtagcaacagtaagagctttaaaaatgcatggaggcatg
gcgaaagctgagctgaagcaagaaaatgttgaagcattaaaagcaggtatggaaaattta
aaaaaacatattgaaacaattgaaacatttggcctgcctttcgtagttgctattaataaa
ttcccttcagatactaaggccgagacagactttatcagtaactggtgcgaatccagggga
tttgaagtagctttaacagatgtatttgcacatggaggagaaggtggcattgagcttgct
caaaaagttgtagagaaagcaaatacttctgataagaattttaagcggatttatgaactg
gatgagtctttagaaacgaaaattagaaaagttgctcaacaagtttatggtgcggatgat
attgaattatccccgaaagcaaaaaaacaaataaccttatatgaagaactggggtgggga
aagcttgccatttgtatggcaaaaacccaatattcactttctgatgacccaacattatta
ggaagaccgcgagattttacaattaatattagagaacttcgaccatccattggtgctgga
tttattgtcgtccttacaggtgatgttatgacaatgcctggtttaccaaaagagcctgcc
gcactgaaaatggatgtatcagaagacggaaaggcagtaggcttattttga

DBGET integrated database retrieval system