KEGG   Virgibacillus halodenitrificans: BME96_15035Help
Entry
BME96_15035       CDS       T04548                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
vhl  Virgibacillus halodenitrificans
Pathway
vhl00620  Pyruvate metabolism
vhl00630  Glyoxylate and dicarboxylate metabolism
vhl01100  Metabolic pathways
vhl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vhl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BME96_15035
   00630 Glyoxylate and dicarboxylate metabolism
    BME96_15035
Enzymes [BR:vhl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     BME96_15035
    1.2.1.22  lactaldehyde dehydrogenase
     BME96_15035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC Neugrin
Motif
Other DBs
NCBI-ProteinID: APC49427
UniProt: A0A1J0H4L2
Position
complement(2981122..2982576)
Genome map
AA seq 484 aa AA seqDB search
MKRHQLYINGEYTDSTGNDWLDIINPATEEMISQAQRGTNEDVDRAVQAAFEAQKSWELI
PNIERGKIVRKLGEAIQEKRETFIELLQEEQGKDYELAQGEVDLAIDYFQYMSEWARRIE
GEIVPSDRPNENIYIYKKPIGVIAGIVPWNFPVFILARKVATALVTGCTIVLKPSQKTPN
TAMAFTEIVDDMDDIPKGVYNVVTGTGSEVGDALTRHEKIAMVSMTGSIPAGTKIMEAAA
QNITKVNLELGGKAPAIVTKHADLEVTVDNIVTSRLANNGQACTNAERVYVHEDIADTFV
SKLKESFESKKIGDPRENKDADVGPLISNERLEAVSSMVEQAKEDGAKVVTGGERAESEK
GYFYKPTILTNVDHQSAIMQDEIFGPVIPIDTFKTLDEAIEKGNDTVYGLSSSVYTDDMN
EAMRVINELKFGETYVNRENFEAVQGYHAGMRKSGLGGTDGKHGVEDFLVTQVVYMQYNK
DKNE
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacatcaattatacattaatggagaatatacagattctacaggaaacgactgg
cttgatattattaaccctgctacagaggaaatgatatcccaagcccaacgaggcacaaat
gaagatgtagatcgagcagttcaagcggcatttgaagctcaaaaatcgtgggagcttatt
ccgaacattgagcgtggaaaaatcgttcgcaaattaggtgaagcgatacaggaaaaacgg
gaaacttttattgaattgttacaagaggagcaaggtaaggattatgagctggcacagggc
gaagttgatttggccattgattattttcaatatatgtctgaatgggcacgcagaatagaa
ggagagattgtcccaagcgatcggccaaatgaaaatatctatatttataaaaaacctatt
ggtgtgattgcgggtattgttccatggaatttccctgtattcattcttgctagaaaagta
gccactgcactcgtcactggctgtaccatagtgttaaaaccaagtcaaaaaacaccaaac
acagcaatggcttttacagaaattgtagatgacatggatgatattcctaaaggtgtttac
aatgtggtcacaggaactggttcggaagttggggatgcattaactagacatgaaaaaatt
gcgatggtttctatgacaggaagtatccctgctggaacaaaaataatggaggctgctgca
caaaatatcaccaaagttaacctcgagctaggagggaaagcacctgctattgtaacgaag
catgctgaccttgaggttactgttgacaacattgtaacatcacgcttagccaataatgga
caagcatgtacaaacgcagagcgtgtatatgtacatgaagatattgctgatacgtttgta
agcaagctgaaagaaagcttcgaaagtaaaaaaattggcgatcctcgagaaaataaggat
gcagatgtaggtcctttaattagtaacgaacggttggaagctgtttcgtcgatggtagag
caagcaaaagaagatggtgcaaaagtagtcactggcggagaacgcgcagaaagtgaaaaa
ggctatttttataaaccgaccatcctgacaaatgtagaccaccagtcagctattatgcag
gatgaaatctttggtccggtgattcctattgatacatttaaaacgttggacgaagcaatc
gaaaaaggtaacgacacggtttatggactctcctcgtctgtatatacggatgatatgaac
gaagccatgcgtgtgattaacgagttaaaatttggtgaaacgtacgtaaatcgcgagaac
tttgaggctgtccaaggttatcatgcaggtatgcgcaaatctggtcttggcggtacggac
ggaaaacatggtgtagaggatttccttgttacacaggttgtttatatgcaatataacaaa
gataaaaacgaataa

DBGET integrated database retrieval system