KEGG   Virgibacillus halodenitrificans: BME96_16975Help
Entry
BME96_16975       CDS       T04548                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vhl  Virgibacillus halodenitrificans
Pathway
vhl00071  Fatty acid degradation
vhl00072  Synthesis and degradation of ketone bodies
vhl00280  Valine, leucine and isoleucine degradation
vhl00310  Lysine degradation
vhl00362  Benzoate degradation
vhl00380  Tryptophan metabolism
vhl00620  Pyruvate metabolism
vhl00630  Glyoxylate and dicarboxylate metabolism
vhl00640  Propanoate metabolism
vhl00650  Butanoate metabolism
vhl00900  Terpenoid backbone biosynthesis
vhl01100  Metabolic pathways
vhl01110  Biosynthesis of secondary metabolites
vhl01120  Microbial metabolism in diverse environments
vhl01130  Biosynthesis of antibiotics
vhl01200  Carbon metabolism
vhl01212  Fatty acid metabolism
vhl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vhl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BME96_16975
   00630 Glyoxylate and dicarboxylate metabolism
    BME96_16975
   00640 Propanoate metabolism
    BME96_16975
   00650 Butanoate metabolism
    BME96_16975
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BME96_16975
   00072 Synthesis and degradation of ketone bodies
    BME96_16975
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BME96_16975
   00310 Lysine degradation
    BME96_16975
   00380 Tryptophan metabolism
    BME96_16975
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BME96_16975
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BME96_16975
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BME96_16975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vhl04147]
    BME96_16975
Enzymes [BR:vhl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BME96_16975
Exosome [BR:vhl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BME96_16975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: APC49780
UniProt: A0A1J0H5K0
Position
complement(3459128..3460315)
Genome map
AA seq 395 aa AA seqDB search
MRKTVIVSGARTPFGKFGGSLKSFTASQLGGKAIEEALKRAQMDGEQIDEVIMGTVLQGG
QGQIPSRQAAREAGIPWHVKTETINKVCASGLRSVTLADQLIRLGDEEVIVAGGMESMSN
APYFLPDARWGNRMGDKTVKDMMIHDGLTCSFKGVHMGNYGNSTAEEYELTREAQDEWSY
RSHQRAGEAIETGKFAEEIVPLEVPQRKGDPIVVDTDEAPRKDTSVEKLAKLKPAFDPNG
TITAGNAPGVNDGACAFVVMSDEKARELGKEPMATVLGHAEVAVEAKDFPQTPGLVINKL
LEKTGHKKEDIDLFEINEAFAAVSLASGKIAGIDQEKVNVNGGAVALGHPIGASGARIIL
TLIHELKRRGGGLGIAAICSGGGQGDAVLIEVSKQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaacggttattgtttcaggtgcgagaacaccttttggcaaatttggcggttct
ttaaaatcattcacagcttcacagcttggtggaaaagcaatagaagaagcgttgaaacga
gctcaaatggatggcgaacagatagatgaagtaattatgggaactgtattacagggagga
cagggacagatcccttccagacaggcagcaagagaagcaggtattccttggcatgtaaaa
acggaaacgataaataaagtatgtgcttccggacttcgaagtgtaacattggctgatcag
ttaatccgtctgggcgatgaagaagtaattgttgctggaggaatggaaagtatgagtaac
gctccttacttcctgccagatgctcgttggggaaatcgtatgggtgataaaaccgttaaa
gatatgatgattcatgatggattgacatgttcttttaaaggcgtccatatgggcaactat
ggtaactctactgcagaagaatatgagttaactagagaggcacaggatgaatggtcatac
aggagtcatcaacgtgctggagaagcgattgaaactggtaaatttgccgaagaaattgtt
ccacttgaagttcctcagcgcaaaggcgatccaattgtagtagatacagacgaagcacca
agaaaagatacaagtgtggagaaactggctaaattaaagcctgcttttgatccaaatgga
actataactgcgggtaatgcgcctggcgtgaatgatggtgcttgtgcttttgtggtgatg
tcagatgagaaagcaagagagctagggaaagaacctatggcaacagtgttgggacatgct
gaggtagctgttgaagcaaaggatttcccgcaaacacctgggctcgtcattaataagctt
ttagaaaaaactggacataaaaaagaggacattgacttatttgaaatcaatgaagcattt
gctgctgtttccttagcaagtggaaaaatcgcaggtattgaccaagaaaaggtaaatgtg
aatggtggagctgttgcattgggacatccaattggagctagtggagccaggattattttg
acattaattcatgaattaaagcgacgcggtggcggacttggtattgctgctatttgcagt
ggtggagggcaaggagatgccgtgttaattgaggtatcgaaacagtaa

DBGET integrated database retrieval system