KEGG   Vibrio harveyi: AL538_14740Help
Entry
AL538_14740       CDS       T04380                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
vhr  Vibrio harveyi
Pathway
vhr00020  Citrate cycle (TCA cycle)
vhr00480  Glutathione metabolism
vhr01100  Metabolic pathways
vhr01110  Biosynthesis of secondary metabolites
vhr01120  Microbial metabolism in diverse environments
vhr01130  Biosynthesis of antibiotics
vhr01200  Carbon metabolism
vhr01210  2-Oxocarboxylic acid metabolism
vhr01230  Biosynthesis of amino acids
Module
vhr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vhr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:vhr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AL538_14740
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AL538_14740
Enzymes [BR:vhr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AL538_14740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AMF98879
UniProt: A0A454B9L9
Position
1:3138129..3140354
Genome map
AA seq 741 aa AA seqDB search
MPTEKPTIIYTITDEAPALATYSLLPIIQSFTASSGINVDTRDISLAGRIIANFPEHLKE
EQRIGDALAELGELAKTPEANIIKLPNISASIPQLKAAIKELQAKGYELPNYPEEPSTYE
EEAIKATYDKIKGSAVNPVLREGNSDRRAPLSVKNYAKKNPHSMGAWSADSQSHVSSMAD
NDFFGSEKSATVSGATDVKIEFVAADGSVKELKSAFPLQDKEVIDCSVMNKKALVEFFEK
EIAEAKQQDVLLSLHMKATMMKVSDPVIFGHAVKVYYKDVFAKYGKLFEELGVDVNNGIG
DVYAKIDALPAEQKAEIEAAILAVYETQPALAMVDSDRGITNLHVPSDIIVDASMPAMLR
ASGQMWGPDGKQKDTKAMIPDRSYAGIYQAVIDFCKEHGAFDPTTMGSVPNVGLMAQKAE
EYGSHDKTFILDAAGTVRVVDASGAVLLEQEVEEGDIFRMCQVKDAPIQDWVKLAVTRAR
ASGAPAVFWLDEARAHDAELIKKVNAYLPAHDTSGLEIKILAPIDACKFSLERIKEGLDT
ISVTGNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQVEKENH
LRWDSLGEFLALAASLEHLSSVAGNAKAQVLADALDKATGEFLDENKSPSRKVGELDNRG
SHYYLASYWAKALAEQTEDADLAAEFAPVAKALAEQEEAIVSELNNAQGVKGELGGYYSL
DDSLASTLMRPSATLNAIINK
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgcctacagaaaaacctacaattatctacacaatcactgatgaagccccggcgttagca
acctattcattactaccaatcattcaatcgtttactgcatcgtctggcattaatgtagat
actcgtgatatttcgttagcaggtcgtatcatcgctaacttcccagagcatttaaaagaa
gaacagcgcatcggtgacgcgctagcagaacttggcgagttggcgaaaacgccagaagca
aacatcatcaaacttccaaacatttctgcatctattccgcagttaaaagctgctatcaaa
gagctgcaagcaaaaggctatgagctaccaaactacccagaagagccgagcacttacgaa
gaagaagcgattaaagcgacttacgacaaaatcaaaggtagtgcggttaacccggttcta
cgcgaaggtaactcagaccgtcgtgcgccactttcagtaaagaattacgcgaagaagaac
ccacactcaatgggtgcatggtcagcggattctcaatctcatgtttcaagcatggcagac
aacgacttcttcggtagtgaaaaatcggcaaccgtttctggtgctactgacgtaaaaatt
gaatttgtcgctgcagatggttcggtgaaagaacttaaatcggcgttccctttacaagac
aaagaagtgatcgattgttcggtaatgaacaagaaagcgcttgttgagttctttgagaag
gaaattgcagaagcaaaacagcaagacgttctgctctctctacacatgaaagcgaccatg
atgaaggtatcggatccagttatctttggtcatgctgttaaggtttactacaaagacgtg
tttgcaaaatacggcaagctattcgaagagctaggcgttgatgtaaacaatggtatcggt
gacgtatacgcgaagatcgacgcgctacctgctgaacaaaaagcggaaatcgaagcggcg
atccttgcggtatacgaaacacaaccagcactcgcgatggttgactcagatcgcggtatt
accaacctgcacgtaccaagtgacatcatcgttgatgcttctatgccagcaatgctgcgt
gcatctggtcaaatgtggggaccagacggcaaacagaaagatactaaagcaatgattcca
gatcgtagctatgcaggtatttaccaagcggttatcgatttttgtaaagaacatggtgca
tttgacccaacaactatgggtagcgtaccaaacgtaggtctaatggctcagaaagctgaa
gaatacggttcacacgataagacattcattttagatgcagcaggtactgtacgtgttgta
gatgcttctggtgcggttcttcttgagcaagaagtagaagaaggtgacatcttccgtatg
tgtcaggtcaaagatgcgccaatccaagattgggtgaaacttgcggtaactcgtgctcgt
gcttcgggtgcgccggctgtgttctggcttgatgaagcgcgtgctcatgatgcagaactt
atcaaaaaagtgaatgcctaccttccagcacacgatacttcaggtctagaaattaagatc
cttgcgccaatcgatgcatgtaaattctctctagagcgtatcaaagaaggtctagatacc
atttctgtaacgggtaacgtattgcgtgattacctgaccgatttgttcccaattttggag
cttggtacttcagcgaagatgctatctatcgttccgctaatgaacggtggtggtctattt
gaaacgggagcaggaggttcggcacctaagcacgttcagcaagttgaaaaagaaaaccac
ttacgttgggattctctaggtgagttccttgcgctggcagcttctctagagcacctaagc
tctgtggcgggcaatgcgaaggctcaagttcttgctgacgctcttgataaagcaacaggc
gagttcttagacgaaaataaatcaccttctcgtaaagtaggtgagttggataaccgtggt
agccattactacttggcatcgtactgggcgaaagcattggctgagcaaacagaagacgcg
gatcttgcagcagagtttgcccctgtcgcaaaagcgttggcagagcaagaggaagcgatt
gtgtctgagctaaacaacgcgcagggtgtaaaaggcgagctaggtggttactactccctt
gatgattctctagcgtctacattgatgcgtccaagcgcaacgctgaacgctattatcaat
aaataa

DBGET integrated database retrieval system