KEGG   Vibrio harveyi: AL538_18445Help
Entry
AL538_18445       CDS       T04380                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vhr  Vibrio harveyi
Pathway
vhr00071  Fatty acid degradation
vhr00072  Synthesis and degradation of ketone bodies
vhr00280  Valine, leucine and isoleucine degradation
vhr00310  Lysine degradation
vhr00362  Benzoate degradation
vhr00380  Tryptophan metabolism
vhr00620  Pyruvate metabolism
vhr00630  Glyoxylate and dicarboxylate metabolism
vhr00640  Propanoate metabolism
vhr00650  Butanoate metabolism
vhr00900  Terpenoid backbone biosynthesis
vhr01100  Metabolic pathways
vhr01110  Biosynthesis of secondary metabolites
vhr01120  Microbial metabolism in diverse environments
vhr01130  Biosynthesis of antibiotics
vhr01200  Carbon metabolism
vhr01212  Fatty acid metabolism
vhr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vhr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL538_18445
   00630 Glyoxylate and dicarboxylate metabolism
    AL538_18445
   00640 Propanoate metabolism
    AL538_18445
   00650 Butanoate metabolism
    AL538_18445
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AL538_18445
   00072 Synthesis and degradation of ketone bodies
    AL538_18445
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AL538_18445
   00310 Lysine degradation
    AL538_18445
   00380 Tryptophan metabolism
    AL538_18445
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AL538_18445
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AL538_18445
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AL538_18445
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vhr04147]
    AL538_18445
Enzymes [BR:vhr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AL538_18445
Exosome [BR:vhr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AL538_18445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMF99707
Position
2:285763..286968
Genome map
AA seq 401 aa AA seqDB search
MERIFIVAAKRTPIGSFNGSLASLSSVELGAHAIKAALEQVDIAPEQIDEVIVGNVLTGG
AGMGPGRQAAMKAGIPESVPAYTLNMICGSGMKVIMDGASHIRAGDAELVLTCGMESMSN
APYISSGQIRRGYRMGHQLQEDSIIKDGLTDAFHNYHMGVTAENIAKQFQISREDQDAFA
LQSQRKAISAIENGHFEAEIAPITIVDRKRQFEVKNDEYPKADSTFEGLQALRPAFDKEG
SVTAGNASGINDGASAILLASESAVKRHNLKPIAELIEYGQGAIAPEVMGLGPVSAIANT
LAKAEMAIEDIDVFELNEAFAAQALGVVRSLTEQHNIDEAWLLERSNLSGGAIALGHPIG
ASGNRIVTTLVYQLQRTRRDYGLASLCIGGGMGTALILKRC
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaatctttattgtggcggcaaagcgcaccccaattggcagctttaatggctca
ttagcgtcattgtctagtgtcgaactgggcgctcatgccatcaaggcagccttggagcaa
gtggacattgccccagaacaaatcgatgaagtgattgttggcaacgtacttactggaggc
gcaggcatgggaccgggtcgccaagccgcaatgaaggcaggcattccagaatccgttccg
gcttacacactcaatatgatttgtggcagtgggatgaaagtcatcatggacggtgcaagc
catattcgagcgggcgacgcagaactagtgcttacttgtggtatggagagtatgtccaac
gcaccatacatctcttccggtcagattcgtcgcggttatcgcatgggtcatcaactccaa
gaagacagcatcatcaaagatggtttgacagatgccttccacaattaccacatgggtgtt
acggcagaaaacatcgccaagcaattccaaatcagccgagaagaccaagatgcctttgcc
ttacaaagccaacgtaaagcgatcagcgcgatagaaaatggtcattttgaagcagaaatt
gcgccaattacgatagtggatcgcaagcgccaattcgaagtaaagaacgatgaatatccg
aaagccgacagcacctttgaaggtctacaagcactgcgtcctgcattcgataaagaaggc
agtgttaccgcaggcaatgcatccggtattaatgatggtgcatccgcaattttgctcgct
tcagaaagtgccgtaaaacgccataacctcaagccaatagctgaactcatcgaatacgga
caaggtgctatcgccccagaggtgatgggcttaggtccagtgtctgcgattgccaatacc
ttagccaaagccgaaatggcgattgaagatatcgacgtttttgagcttaacgaagccttt
gctgcgcaagcacttggcgtggttcgttcccttaccgagcaacacaatatcgatgaagcg
tggctgctagaacgcagtaacttaagtggcggtgccattgcacttggtcacccaatcggc
gcatcaggtaaccgcattgtgaccaccttggtttatcaactgcagcgcactcgccgtgat
tacggtttggcatcactgtgcatcggcggtggcatgggcacggcgttaattttgaaacgt
tgttag

DBGET integrated database retrieval system