KEGG   Vibrio harveyi: AL538_21800Help
Entry
AL538_21800       CDS       T04380                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
vhr  Vibrio harveyi
Pathway
vhr00230  Purine metabolism
vhr00250  Alanine, aspartate and glutamate metabolism
vhr01100  Metabolic pathways
Module
vhr_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:vhr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AL538_21800
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AL538_21800
Enzymes [BR:vhr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     AL538_21800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AMG00326
UniProt: A0A454BDP5
Position
2:complement(1020519..1021775)
Genome map
AA seq 418 aa AA seqDB search
MSSIVVVGANWGDEGKGRIVDFLAEQASASIRFQGGNNAGHTVVNDLGTFKLHQLPSGVF
NPDCLAVLGPGMVISPASLSQEITEVEEAGVKVNMCISDRATLCLPLHALEDTLEEQRLG
DKAYGSTRQGIAPAYGDRVMKKGILVGWLKQPEVLVERIKFWMEWKLPQLRALYPTFEFE
QTAEEMASWLLEVSAPWRDAICNVTLPLKELQAKDQTLLFEAQLGAGRDLVYGEYPWTTS
SNVVSMYAGIGSGLPALRPERVIAVAKAFSSSVGTGTLITAMEEQDAFRELAGEFGATTG
RPRDMGYFDAVATKNGVELQAATEIALTKVDCLTGLKDLKICVGYEGEHSENPIWPQTAA
LAPIYEKMESWSEDITGCRKFEELPVAAQKYVLRIEELMGVPVKMVSVGPGREQMIMR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctatcgttgttgtgggtgcaaactggggtgatgaaggcaaaggccgcatcgtt
gactttttggcagagcaagcttctgcaagcattcgtttccaaggtggtaacaacgcgggt
cataccgtagttaacgacctaggtacgtttaagctacaccagctaccaagtggcgttttc
aaccctgactgtttggcagtattaggtccgggtatggtaatcagtccagcgtcgctgtct
caggagattacggaagttgaagaagcgggcgttaaagtgaacatgtgcatctctgatcgc
gcaacactgtgtctacctctacacgcactagaagatacgctagaagaacaacgcttaggc
gacaaagcatacggttcaactcgtcaaggtattgcacctgcatacggcgaccgtgtgatg
aaaaaaggcatcctagttggttggttgaagcagccagaagtcctagtagagcgcatcaaa
ttctggatggagtggaaacttcctcaactacgtgcgctttacccaacgttcgagtttgaa
caaaccgctgaagagatggcgagctggttgttagaagtatctgcaccttggcgtgacgct
atctgcaacgtaacgctgccgctaaaagaactgcaagcaaaagaccaaactctactgttc
gaagcgcagctaggtgcaggtcgtgaccttgtttacggtgagtacccatggacaacatct
tcaaacgttgtgtctatgtatgctggtatcggtagtggtcttcctgctcttcgtccagag
cgtgttattgcggtagcaaaagcgttcagctcatcggtaggtaccggcacactaattact
gcaatggaagagcaagatgcattccgtgaactagcgggtgagttcggtgcaacaacaggt
cgtccacgtgacatgggttacttcgatgcagtagcaacgaagaacggtgttgagcttcaa
gcagcgactgaaatcgcactgacaaaagtggactgtctgactggtcttaaagatctaaaa
atctgtgttggttacgaaggcgagcacagcgaaaacccaatttggcctcaaacggctgca
ctagcaccaatctacgagaagatggaaagctggagcgaagacattactggttgtcgtaaa
ttcgaagagctaccagtcgcggcacaaaaatacgttctacgtattgaagagctgatgggt
gtacctgtgaagatggtatcggttggtcctggtcgtgaacaaatgattatgcgctaa

DBGET integrated database retrieval system