KEGG   Vibrio harveyi: AL538_23665Help
Entry
AL538_23665       CDS       T04380                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vhr  Vibrio harveyi
Pathway
vhr00071  Fatty acid degradation
vhr00072  Synthesis and degradation of ketone bodies
vhr00280  Valine, leucine and isoleucine degradation
vhr00310  Lysine degradation
vhr00362  Benzoate degradation
vhr00380  Tryptophan metabolism
vhr00620  Pyruvate metabolism
vhr00630  Glyoxylate and dicarboxylate metabolism
vhr00640  Propanoate metabolism
vhr00650  Butanoate metabolism
vhr00900  Terpenoid backbone biosynthesis
vhr01100  Metabolic pathways
vhr01110  Biosynthesis of secondary metabolites
vhr01120  Microbial metabolism in diverse environments
vhr01130  Biosynthesis of antibiotics
vhr01200  Carbon metabolism
vhr01212  Fatty acid metabolism
vhr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vhr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL538_23665
   00630 Glyoxylate and dicarboxylate metabolism
    AL538_23665
   00640 Propanoate metabolism
    AL538_23665
   00650 Butanoate metabolism
    AL538_23665
  Lipid metabolism
   00071 Fatty acid degradation
    AL538_23665
   00072 Synthesis and degradation of ketone bodies
    AL538_23665
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AL538_23665
   00310 Lysine degradation
    AL538_23665
   00380 Tryptophan metabolism
    AL538_23665
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AL538_23665
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AL538_23665
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AL538_23665
Enzymes [BR:vhr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AL538_23665
Exosome [BR:vhr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AL538_23665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMG00677
Position
2:1482438..1483649
Genome map
AA seq 403 aa AA seqDB search
MGNDIWIVSAKRTPIGRFQGQLQSYSAPQLGAFAIKAAIDASGVSEVDEVYMGCVLPAGC
GQAPARQAALGADLPLTTGCTTINKVCGSGMKSVMLAHDLIKAGSIRSAIAGGMESMTNA
PYLLKEARNGMRMGHQSTYDHMFLDGLQDAYEGHLMGVYAQQTADRSEFTREQMDEWAIL
SATRALEAQEQHLFDGEISPIEITTRHSTSTLDYDEHPRSIKLDKIPQLKPAFDKNGSVT
AANSSAISDGAAALVLMDSQVAQHQGLTPLAIIKGHSTHARKPAEFTLAPVFAIEQLLSQ
LDWSVDEVDLWEINEAFAVVTQIAVRQLGIDKGKVNIKGGACALGHPIGASGARILVTLI
HSLRQLQSLGVDGDNNNKKVMRGVASLCIGGGEATAIGIEIPL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgacatctggattgtcagtgcaaagcgaacgccaatcgggcgctttcaaggt
cagttacaaagttattcagcgcctcaattaggggcatttgctatcaaagcggcaatagat
gcgagcggcgttagcgaagtcgacgaagtctacatgggctgcgtattacctgcggggtgc
ggacaagcaccagccagacaagcagcgctaggtgcagatcttccactgacgacaggctgt
accactatcaataaagtgtgtggctctggcatgaaaagcgtcatgttagctcacgatctt
atcaaagcgggcagcattcgcagcgccatcgctggtggtatggaaagcatgaccaatgcg
ccgtacctgcttaaagaagcacgtaacggcatgcgaatgggtcaccaatctacctatgac
catatgtttctcgacggtcttcaagatgcgtatgaagggcatttgatgggagtttacgcg
cagcaaacagctgatcgctctgagtttacccgtgaacaaatggatgaatgggcgatccta
tctgcgacaagagcattggaagcgcaagagcagcatctgtttgacggcgagatctcgccg
atagaaatcacaactcgtcatagcacttcaacattggattatgacgagcatccacgctcc
atcaagctcgacaagatcccccagctcaaacccgcgttcgataagaacggctcggtgacg
gctgcaaactcaagtgcgatatccgatggtgctgcagccttggtgttaatggactcgcag
gtggcacagcatcaaggtttaacgccattagcaatcatcaaagggcactcgacccacgcc
agaaagcccgccgaatttaccctcgcgcccgtctttgcaatagagcagttgttatctcaa
ctcgattggtcagtagatgaggttgacctttgggagatcaacgaagctttcgccgttgtc
acgcaaatcgcggtacgccaattaggcattgataaaggcaaagtaaatatcaaaggcggt
gcgtgtgcgcttgggcatccaattggcgcaagcggagctcgtattttagtgaccctcatt
catagcctgcgccaactgcaatcgcttggtgtagatggtgacaacaacaataaaaaagtg
atgcgaggtgttgcatcactttgtatcggtggtggtgaagccactgctattggtatcgag
ataccgctttaa

DBGET integrated database retrieval system