KEGG   Virgibacillus sp. 6R: BKP57_05490Help
Entry
BKP57_05490       CDS       T04596                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
vig  Virgibacillus sp. 6R
Pathway
vig00740  Riboflavin metabolism
vig00790  Folate biosynthesis
vig01100  Metabolic pathways
vig01110  Biosynthesis of secondary metabolites
Module
vig_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:vig00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BKP57_05490
   00790 Folate biosynthesis
    BKP57_05490
Enzymes [BR:vig01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     BKP57_05490
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     BKP57_05490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase
Motif
Other DBs
NCBI-ProteinID: API91343
Position
complement(1224398..1225021)
Genome map
AA seq 207 aa AA seqDB search
MHTIEDAVKDLKAGKPVIVVDDESRENEGDFVALSASITPAVVNFMITHGKGLVCTAVGS
EIAKRLGLTLMPSTQTDSYATAFTISVDHKETTTGISAIDRATTIRALANSFAVKEDFHQ
PGHVFPLIARDGGVLVRQGHTEAAVDLAKLCGASPSGTICEIINSDGSMARLADLEKIAE
QFSLQLISVQQLVAYRINENEECDVIE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaatagaagatgcagtcaaggatttgaaagcaggcaagccagttattgtggtt
gatgatgaaagtcgggaaaatgaaggtgactttgttgctttatcagcatcaattactcca
gcagtcgttaatttcatgataacgcatggtaaaggattagtatgtacagcagtgggtagc
gaaatagcaaagcggcttggattgacattaatgccatcaacacaaacagactcatatgct
accgcatttaccattagtgtcgatcataaggaaacaacaacagggattagtgcaattgat
cgagcaacaacgattcgagcactcgctaactcattcgctgtaaaagaggattttcatcag
cccggacatgtattcccattaattgctcgagatggtggagtgcttgtacgccaaggtcat
acggaagcagctgtagatttggctaaattatgtggagctagtccttcaggaactatatgt
gaaattataaatagcgatggttccatggcaaggctagcagacttggaaaaaatcgctgaa
caatttagtttgcagctcatatctgtacagcaattagtagcatatcgaataaatgagaac
gaggagtgtgacgtcattgagtaa

DBGET integrated database retrieval system