KEGG   Virgibacillus sp. 6R: BKP57_15250Help
Entry
BKP57_15250       CDS       T04596                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vig  Virgibacillus sp. 6R
Pathway
vig00071  Fatty acid degradation
vig00072  Synthesis and degradation of ketone bodies
vig00280  Valine, leucine and isoleucine degradation
vig00310  Lysine degradation
vig00362  Benzoate degradation
vig00380  Tryptophan metabolism
vig00620  Pyruvate metabolism
vig00630  Glyoxylate and dicarboxylate metabolism
vig00640  Propanoate metabolism
vig00650  Butanoate metabolism
vig00900  Terpenoid backbone biosynthesis
vig01100  Metabolic pathways
vig01110  Biosynthesis of secondary metabolites
vig01120  Microbial metabolism in diverse environments
vig01130  Biosynthesis of antibiotics
vig01200  Carbon metabolism
vig01212  Fatty acid metabolism
vig02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BKP57_15250
   00630 Glyoxylate and dicarboxylate metabolism
    BKP57_15250
   00640 Propanoate metabolism
    BKP57_15250
   00650 Butanoate metabolism
    BKP57_15250
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BKP57_15250
   00072 Synthesis and degradation of ketone bodies
    BKP57_15250
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BKP57_15250
   00310 Lysine degradation
    BKP57_15250
   00380 Tryptophan metabolism
    BKP57_15250
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BKP57_15250
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BKP57_15250
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BKP57_15250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vig04147]
    BKP57_15250
Enzymes [BR:vig01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BKP57_15250
Exosome [BR:vig04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BKP57_15250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD Dodecin
Motif
Other DBs
NCBI-ProteinID: API93044
Position
3417577..3418758
Genome map
AA seq 393 aa AA seqDB search
MKQRDIVLLEGARTPFVNFNGKFKDITAIELGVIAAKEAIKKANISSDQIDQVVFGNVQQ
SSKDAHLLARHIGLKVGTPIHVPAVTINRVCGTGIEVILAGARHILAGEADVVLAGGTEN
MSQVPHVVRGMRSGSPLGAVKVEDWLWEGLEDTNVGCTMAQTAENLAEKYEISREEVDQH
ALSSHQRAICARDNGYFKEEIVSVTVKGRKGEMVVDEDDHIRETSMEQLAKLKPRFVENG
VVTPGNASGMVDGAAAVVIATSEYAERNGLRPIARLVAWDVVGVQPEHMGIGPVPAIRGA
VEKAKLTVDDLNLIEINEAFSAQYVACQKELGFNLEKGNVNGGAIAIGHPLAASGTRISL
SLIYELRRRHLRFGVSSACIGGGQGIAAVWEAL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagagggatatcgtattactagaaggtgcacgtacgccatttgtgaattttaat
gggaagtttaaagatattactgcaattgaattgggtgtgattgcagctaaagaggcaatt
aagaaagcaaatatttcttccgatcagattgaccaggttgtatttggtaatgtacaacaa
tcttcaaaggatgctcatctacttgcaaggcatattggtttgaaagtaggaacgcctatc
catgtaccagcagttaccattaatcgcgtatgcggcacggggattgaggtcattcttgct
ggagcacgtcatattcttgctggagaggcagatgttgttttagcaggtggtacggaaaat
atgagtcaagttccacatgtcgtcaggggaatgcgttcaggcagcccgcttggcgctgtg
aaggtagaggactggttatgggaagggcttgaagatacaaatgtaggctgtacgatggca
caaacagctgaaaatcttgctgagaaatatgaaatatcacgtgaagaagtggatcaacat
gcgttatccagtcaccaacgtgctatttgtgctagagataatgggtatttcaaagaagaa
atagtttcagttactgtaaaaggtagaaaaggggaaatggtcgttgatgaagatgatcat
attcgtgagacaagtatggaacaattagcgaaattaaaacctcggtttgtagaaaatggg
gtagtaacgccaggaaatgcaagtggtatggtggatggagcagcagcagttgtgatcgcc
acgagtgagtacgcagaaagaaatggacttagaccaattgccagactcgttgcatgggat
gttgtaggtgtacagccggaacatatggggattgggcctgtacccgcgataagaggtgca
gttgaaaaggcaaagcttacagttgatgatttaaatttaattgaaattaacgaggcattc
tctgcacaatatgtggcttgccaaaaagaattaggctttaatttagaaaaaggaaatgta
aatggtggggcaatcgctattgggcatccattggcagcgagtggcactaggatttctctt
tctcttatttatgaattaagacgccgccatctgagatttggtgtttcctcagcgtgtata
ggtggaggtcaaggaatcgcagcagtatgggaagcactatag

DBGET integrated database retrieval system