KEGG   Virgibacillus sp. 6R: BKP57_18800Help
Entry
BKP57_18800       CDS       T04596                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
vig  Virgibacillus sp. 6R
Pathway
vig00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:vig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BKP57_18800
Enzymes [BR:vig01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BKP57_18800
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BKP57_18800
    1.1.1.-  
     BKP57_18800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc NADH_4Fe-4S ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: API93680
Position
4241718..4242767
Genome map
AA seq 349 aa AA seqDB search
MKAAVWYAKKDIRVENVDEPVVEAGEVKIKVEWAGICGSDLHEYVAGPITIPTEAPHPLT
KGTAPVIMGHEFAGEVVEVGKNVTQVALGDRVTVEPMITCGKCKACRQGRYNLCEVIAAF
GMSGVGGGFSEYTVVSEDMVHKIPEHMSYELAALVEPTAVAMHAVKLSNLKVGDTVAVFG
AGPIGLLTVQASFLAGAKKVFAIELSEERRKVATKLGAVAISPAESDVAEEIMKQTAGDG
ADISFEATGVPVVLEQAVNSTKMGGEIVIESLWESKPELDANSLVFKELNLIGSIGYRNI
FPTVIDLIADGKLEVSDLVTKKIALDNIVKEGFESLLQEKSQVKILIKP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtttggtatgcaaaaaaagatatccgtgtggagaatgttgatgaacca
gttgttgaagcaggagaagtgaaaatcaaagtagaatgggccggtatttgtggaagcgat
cttcatgaatatgttgctggaccaattaccatcccaacagaagcacctcatccattaaca
aaaggtactgcaccagttattatgggtcatgaatttgccggagaggtagtagaagttggg
aaaaacgttacccaagtagcgttaggggatcgagttactgtggagccgatgattacttgc
gggaaatgtaaagcctgccgtcaagggcgttataacctttgtgaagtcattgcagctttt
ggcatgtctggtgttggtggaggcttctcagagtataccgttgtttctgaagacatggta
cataaaatacctgagcatatgagctatgaattagctgctttagttgaacctacagcagtt
gctatgcatgctgtaaaacttagtaacttaaaggttggggatacagtagctgtttttgga
gccggaccaattggcttattaacggtacaagcaagctttttagctggagcaaaaaaggta
tttgccattgaattgtcagaagaacgaagaaaagtagcaaccaagcttggggcagttgct
attagtccagcagagagtgacgttgctgaagagatcatgaagcaaaccgcaggcgatgga
gctgatatcagttttgaggctacaggtgttcctgtagtattagaacaagcagttaatagc
acaaaaatgggcggagaaattgttattgaaagtctttgggagtcaaaaccggaattggat
gctaacagccttgtttttaaagaacttaacttgatcggatcgattggttaccgcaatata
ttcccgacagtgattgatttaattgctgatggtaagctggaagtaagcgatttagttacg
aaaaaaatcgcattggataacatcgtgaaggaagggtttgagtctttactgcaagaaaaa
tcacaagtgaaaatattaattaaaccgtaa

DBGET integrated database retrieval system