KEGG   Virgibacillus phasianinus: CFK37_07705Help
Entry
CFK37_07705       CDS       T04951                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vil  Virgibacillus phasianinus
Pathway
vil00071  Fatty acid degradation
vil00072  Synthesis and degradation of ketone bodies
vil00280  Valine, leucine and isoleucine degradation
vil00310  Lysine degradation
vil00362  Benzoate degradation
vil00380  Tryptophan metabolism
vil00620  Pyruvate metabolism
vil00630  Glyoxylate and dicarboxylate metabolism
vil00640  Propanoate metabolism
vil00650  Butanoate metabolism
vil00900  Terpenoid backbone biosynthesis
vil01100  Metabolic pathways
vil01110  Biosynthesis of secondary metabolites
vil01120  Microbial metabolism in diverse environments
vil01130  Biosynthesis of antibiotics
vil01200  Carbon metabolism
vil01212  Fatty acid metabolism
vil02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFK37_07705
   00630 Glyoxylate and dicarboxylate metabolism
    CFK37_07705
   00640 Propanoate metabolism
    CFK37_07705
   00650 Butanoate metabolism
    CFK37_07705
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CFK37_07705
   00072 Synthesis and degradation of ketone bodies
    CFK37_07705
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CFK37_07705
   00310 Lysine degradation
    CFK37_07705
   00380 Tryptophan metabolism
    CFK37_07705
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CFK37_07705
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CFK37_07705
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CFK37_07705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vil04147]
    CFK37_07705
Enzymes [BR:vil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CFK37_07705
Exosome [BR:vil04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CFK37_07705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: ASK62052
UniProt: A0A220U239
Position
1519033..1520223
Genome map
AA seq 396 aa AA seqDB search
MAKAVIISGARTPFGKFGGALKPFTASQLGGKAIRGALDRAGLEENEIDEVIMGTVLQGG
QGQIPSRQAAREAGIPWDVKTETINKVCASGLRSVTLADQLIRLGDESVIVAGGMESMSN
APYFLPDARWGNRMGDKSVKDMMVHDGLTCSFNNVHMGNYGNGTAEKHELSREQQDEWSY
RSHQRAVEAIENGKFAEEIVPLEVQKRKGDPIVVDTDEAPRKDTTLEKLAKLRPAFGSDG
TITAGNAPGVNDGAAAFVVMSEEKAEQLGKTPMATVLGHAEVAVEAKNFPETPGLVINRL
LEKTGHSIDDIDLFEINEAFAVVSLASGKIAGVDPEKVNVNGGAVALGHPIGASGSRIIL
TLIHELKRRGGGLGIAAICSGGGQGDAILIEVPKIN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagctgtaatcatatctggagcacgtacaccttttggaaaatttggaggagca
ttaaagccttttactgcatcacaattgggagggaaagctatccgcggggcacttgatcgt
gcaggacttgaagaaaatgaaattgatgaggtaatcatggggactgtactgcaaggtggc
cagggacaaattccgtcccgacaagctgcgcgtgaagcaggtattccttgggatgtgaaa
acagaaacaatcaataaagtgtgcgcatcaggtctgcgcagtgtaacccttgcagatcaa
ttgattcgccttggtgatgagtcggtcattgtagctggtggaatggaaagcatgagcaac
gcaccatatttcttgcctgatgctcgctggggtaaccgcatgggcgataaatcagtgaaa
gatatgatggttcacgatggtctgacatgttcgtttaataacgttcatatgggcaactac
ggaaatggcaccgccgagaaacatgaattatcaagagaacagcaggatgagtggtcatac
cgttcccatcagcgcgcagttgaggcgatcgagaatgggaaatttgctgaagaaatcgta
ccgttagaggttcaaaaacgaaaaggagatccaattgtcgtggatacagatgaggcgccg
cgcaaggatacaaccttagagaagctggctaaattacgcccggcgtttggttcagacgga
acaattactgccggtaatgcaccaggagtcaatgatggagcagcagcgtttgttgtgatg
tctgaagaaaaggcagaacaacttggcaagacgccaatggcaacagtactgggtcatgca
gaggttgctgtggaagcaaagaacttccctgaaactcctggacttgttattaatcgattg
ctggaaaagaccggacattcaatcgatgacattgatttatttgagattaatgaagcattt
gcagttgtatcgcttgcaagtggtaaaatagctggcgttgatccggagaaagtcaatgtg
aatggcggagcagttgcacttggtcatccaattggggcaagtggttctcgcattatttta
acattgattcatgaattaaaacgccgcggcggtggactaggcattgcagcaatttgcagc
ggtggcggtcaaggagacgcaatcttaatagaagttcctaaaattaattaa

DBGET integrated database retrieval system