KEGG   Vulgatibacter incomptus: AKJ08_1204Help
Entry
AKJ08_1204        CDS       T04035                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vin  Vulgatibacter incomptus
Pathway
vin00071  Fatty acid degradation
vin00072  Synthesis and degradation of ketone bodies
vin00280  Valine, leucine and isoleucine degradation
vin00310  Lysine degradation
vin00362  Benzoate degradation
vin00380  Tryptophan metabolism
vin00620  Pyruvate metabolism
vin00630  Glyoxylate and dicarboxylate metabolism
vin00640  Propanoate metabolism
vin00650  Butanoate metabolism
vin00900  Terpenoid backbone biosynthesis
vin01100  Metabolic pathways
vin01110  Biosynthesis of secondary metabolites
vin01120  Microbial metabolism in diverse environments
vin01130  Biosynthesis of antibiotics
vin01200  Carbon metabolism
vin01212  Fatty acid metabolism
vin02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AKJ08_1204
   00630 Glyoxylate and dicarboxylate metabolism
    AKJ08_1204
   00640 Propanoate metabolism
    AKJ08_1204
   00650 Butanoate metabolism
    AKJ08_1204
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AKJ08_1204
   00072 Synthesis and degradation of ketone bodies
    AKJ08_1204
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AKJ08_1204
   00310 Lysine degradation
    AKJ08_1204
   00380 Tryptophan metabolism
    AKJ08_1204
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AKJ08_1204
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AKJ08_1204
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AKJ08_1204
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vin04147]
    AKJ08_1204
Enzymes [BR:vin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AKJ08_1204
Exosome [BR:vin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AKJ08_1204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKU90817
UniProt: A0A0K1PBE5
Position
1458684..1459868
Genome map
AA seq 394 aa AA seqDB search
MADKREVVIVGAARTPIGAFLGSLSSMTAPKLGAVAIKAALERAGVKPESVGHVIMGNVL
QAGVGQAPARQAAIFAGIPELTPAVTLNKVCGSGLEAVVQGARAIMLGDAEVVVAGGMES
MSNAPYLSYTERTGARMGDVKLVDAMIKDGLWDVYGDFHMGIAAEVCAKTQDIPRAAQDE
YAIESTRRAVEAQKSGAFNAEIVPVEVKGKRGDVTVVSEDEGPKGARPDKIPTLKPVFQK
DGTVTAANASSINDGAAAVVLMSKERAEKEGRTILGKIVSYGHAARKPEEFTIAPADSIR
NALDRAKLKTTDIDLYEINEAFAVVSIANNQILGLDSSNVNVRGGAVCLGHPIGSSGTRV
LVTLLYAMKDMDKKRGLASLCIGGGEGIALIVER
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaagcgcgaagtggtgatcgtcggtgcggcgcgcacgccgattggtgcgttc
ctcggctcgctttcgtcgatgacggcgccgaagctcggcgcggtggcgatcaaggcggcc
ttggagcgcgcgggcgtgaagcccgagtcggtcgggcacgtgatcatgggcaacgtcctc
caggcgggcgtcggccaggcccccgctcgccaggccgccatcttcgccgggatcccggag
ctgacccccgcagtgacgctgaacaaggtctgcggctcgggcctcgaggcggtggtgcag
ggcgctcgcgcgatcatgctcggcgacgccgaggtggtggtcgccggcggcatggagtcg
atgtcgaacgcgccgtacctctcctacacggagcgcacgggcgcccggatgggcgacgtc
aagctcgtcgacgcgatgatcaaggacggcctctgggacgtgtacggcgacttccacatg
ggcatcgccgccgaggtctgcgccaagacccaggacatcccgcgggcggcccaggacgag
tacgccatcgagtcgacccgccgcgcagtggaggcccagaagtcgggcgccttcaacgcc
gagatcgtcccggtcgaggtgaagggcaagcgcggcgacgtcacggtggtgagtgaggac
gagggcccgaagggcgcgcgccccgacaagatccccacgctgaagccggtgttccagaag
gacggcacggtcaccgccgccaacgcctcgtcgatcaacgacggcgccgcggcggtggtc
ctgatgtcgaaggagcgcgccgagaaggaaggccgcacgatcctcggcaagatcgtgtcc
tacggccacgccgcccgtaagcccgaggagttcacgatcgcgccggcggactcgatccgc
aacgcgctcgaccgggccaagctgaagaccacggacatcgacctctacgagatcaacgag
gccttcgcggtggtgtccatcgcgaacaaccagatcctcggcctcgacagctcgaacgtg
aacgtccgcggcggcgccgtctgcctgggccaccccatcggctcgtccggcacccgcgtc
ctggtcacgctgctctacgccatgaaggacatggacaagaagcgcggcctcgcgagcctc
tgcatcggcggcggcgagggcatcgccctcatcgtcgagcgctga

DBGET integrated database retrieval system