KEGG   Vulgatibacter incomptus: AKJ08_1918Help
Entry
AKJ08_1918        CDS       T04035                                 

Definition
(GenBank) Glycyl-tRNA synthetase alpha chain
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
vin  Vulgatibacter incomptus
Pathway
vin00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:vin00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AKJ08_1918
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vin01007]
    AKJ08_1918
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vin03016]
    AKJ08_1918
Enzymes [BR:vin01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     AKJ08_1918
Amino acid related enzymes [BR:vin01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   AKJ08_1918
Transfer RNA biogenesis [BR:vin03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AKJ08_1918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e N-glycanase_C
Motif
Other DBs
NCBI-ProteinID: AKU91531
UniProt: A0A0K1PDP1
Position
complement(2287079..2287975)
Genome map
AA seq 298 aa AA seqDB search
MLTFQDLILTLQRYWASRGCILGQAYDSEVGAGTFNPQTFLRALGPEPWKVAYVQPSRRP
ADGRYGENPNRLYQHHQFQVLLKPSPKNVQELYLGSLRAIGIDPLEHDIRFVHDDWESPT
LGAWGLGWEVWCDGMEITQFTYFQQAGGIELRPVSVELTYGLERICMYLQNKSNVFDIDF
GGGISYGEVFRANEVEMSTYSFQASDHPMLFGLFETYEAECKRLLEKELPLPAYDYALKC
SHAFNNLDAGGAISVTERQGYILRVRNLSRACAEGYLAMRERLGFPLLQSAWAKSEDR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccttccaggatctcatcctcacgctgcagcggtactgggcgagccgcggctgc
atcctcgggcaggcctacgactccgaggtcggcgccggcacgttcaatccccagaccttc
ctgcgcgccttggggcccgagccgtggaaggtcgcctacgtgcagccctcgcgcaggccg
gcggacggccgatacggcgagaacccgaaccgcctctaccagcaccaccagttccaggtg
ctcctcaagccgtctcccaagaacgtgcaggagctctacctgggctcgctccgcgcgatc
gggatcgatcccctcgagcacgacatccgtttcgtccacgacgactgggagtcgcccacc
ctcggcgcatggggcctcggctgggaggtctggtgcgacgggatggagatcacccagttc
acctacttccagcaggcgggcgggatcgagctccggccggtgagcgtggagctcacctac
ggcctcgagcggatctgcatgtacctgcagaacaaatcgaacgtcttcgacatcgatttc
ggcggcgggatctcctacggcgaggtcttccgggccaacgaggtggagatgtccacctac
tcgttccaggcctccgatcacccgatgctcttcggcctcttcgagacctacgaggcggag
tgcaagaggctcctcgagaaggagctcccgctcccggcgtacgactacgccctcaagtgc
tcgcacgccttcaacaacctggacgcgggcggcgcgatcagcgtcaccgagcgccagggc
tacatcctccgcgtgcgcaacctctcccgcgcctgcgcggagggctacctcgccatgcgt
gagcggctcggcttccccctgctgcagtctgcctgggcaaagtcggaggatcgctga

DBGET integrated database retrieval system