KEGG   Virgibacillus sp. SK37: X953_00705Help
Entry
X953_00705        CDS       T03219                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
vir  Virgibacillus sp. SK37
Pathway
vir03010  Ribosome
Brite
KEGG Orthology (KO) [BR:vir00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    X953_00705
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:vir03011]
    X953_00705
Ribosome [BR:vir03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    X953_00705
  Bacteria
    X953_00705
  Archaea
    X953_00705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AIF42053
UniProt: A0A075JPI1
Position
141342..141683
Genome map
AA seq 113 aa AA seqDB search
MQAKAIAKSVRIAPRKVRLVVDLIRGKNVGEAVAILRHTQRGASPVVEKVLKSAIANAEH
NYEMDPDNLVISEAFVNEGATLKRFRPRAQGRASKINKRTSHITVVVTEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaaaagccattgcgaaatcggttcgtattgctcctcgtaaagttcgtttagtt
gttgatctaattcgaggaaaaaacgttggtgaagcagttgcaattttacgtcatacacaa
cgtggtgcttctccagtcgtagagaaagttttgaagtctgctattgcaaacgcggaacat
aactacgaaatggatccagataatctagtgatttctgaagcatttgtaaatgaaggtgca
acactgaaacgcttccgtccacgtgctcaaggacgtgcaagtaagattaataaacgcaca
agccacattactgtggttgttacagaaaagaaggagggatag

DBGET integrated database retrieval system