KEGG   Virgibacillus sp. SK37: X953_09705Help
Entry
X953_09705        CDS       T03219                                 

Gene name
glyQ
Definition
(GenBank) glycyl-tRNA synthase subunit alpha
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
vir  Virgibacillus sp. SK37
Pathway
vir00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:vir00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    X953_09705 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vir01007]
    X953_09705 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vir03016]
    X953_09705 (glyQ)
Enzymes [BR:vir01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     X953_09705 (glyQ)
Amino acid related enzymes [BR:vir01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   X953_09705 (glyQ)
Transfer RNA biogenesis [BR:vir03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    X953_09705 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: AIF43400
UniProt: A0A075JNX4
Position
1781465..1782352
Genome map
AA seq 295 aa AA seqDB search
MNIQEMILTLQKHWSEQNCIIMQAYDVEKGAGTMSPMTLLRSLGPEPWNVAYVEPSRRPA
DGRYGNNPNRLYQHHQFQVIMKPSPENIQDLYLESLKKLGINPLEHDIRFVEDNWENPTL
GAAGLGWEVWLDGMEITQFTYFQQIGGLEANPVAVELTYGIERLASYIQDKENVFDLEWT
NGVTVRDIFYQPEVEHSTYTFEDSNTDMLFQLFSMYEQEAKVTMEKGLVFPSYDYVLKCS
HTFNLLDAKGVISVTERTGYISRIRNLARNIAKAYVAERERLGFPMLKEGGKNNE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
ttgaacatacaggaaatgatcttaacgttacaaaagcattggtctgaacaaaattgtatt
atcatgcaggcatatgatgtagaaaaaggtgccggtacaatgtcacccatgacactatta
agaagtttagggccggaaccttggaatgttgcttatgtagaaccatcaaggcgccctgct
gacggaagatatggaaataacccaaatcgtttataccaacaccatcaattccaagttata
atgaagccttctccagaaaatatacaggatttgtatttggagtcattaaaaaaactcggt
attaaccctttggaacatgatatacgatttgttgaggataattgggaaaaccctactctc
ggtgcagcaggccttggttgggaagtttggctagatggcatggagattactcaattcacc
tatttccaacaaattggcgggttagaagcaaatccagttgccgttgaactaacttatggt
attgaacgtttagcatcctatattcaggataaggaaaatgtatttgatctggaatggacc
aatggtgtaactgtaagagatattttttatcaaccggaagttgaacactctacctacaca
tttgaggattcaaatacagatatgttatttcagttgttttccatgtatgagcaagaagcc
aaggtaacaatggaaaaaggccttgtgttcccttcctatgattatgttttaaaatgctcc
cacacatttaacttattggatgctaaaggagtaatttctgttactgaaagaactggatat
atttccagaataagaaatctcgcaagaaatatagctaaagcttatgttgctgaaagggaa
cgtttgggatttcctatgttgaaagaaggaggaaagaataatgagtaa

DBGET integrated database retrieval system