KEGG   Virgibacillus sp. SK37: X953_13845Help
Entry
X953_13845        CDS       T03219                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vir  Virgibacillus sp. SK37
Pathway
vir00280  Valine, leucine and isoleucine degradation
vir00310  Lysine degradation
vir00362  Benzoate degradation
vir00380  Tryptophan metabolism
vir00620  Pyruvate metabolism
vir00630  Glyoxylate and dicarboxylate metabolism
vir00640  Propanoate metabolism
vir00650  Butanoate metabolism
vir00900  Terpenoid backbone biosynthesis
vir01100  Metabolic pathways
vir01110  Biosynthesis of secondary metabolites
vir01120  Microbial metabolism in diverse environments
vir01130  Biosynthesis of antibiotics
vir01200  Carbon metabolism
vir01212  Fatty acid metabolism
vir02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    X953_13845
   00630 Glyoxylate and dicarboxylate metabolism
    X953_13845
   00640 Propanoate metabolism
    X953_13845
   00650 Butanoate metabolism
    X953_13845
  09103 Lipid metabolism
   00071 Fatty acid degradation
    X953_13845
   00072 Synthesis and degradation of ketone bodies
    X953_13845
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    X953_13845
   00310 Lysine degradation
    X953_13845
   00380 Tryptophan metabolism
    X953_13845
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    X953_13845
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    X953_13845
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    X953_13845
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vir04147]
    X953_13845
Enzymes [BR:vir01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     X953_13845
Exosome [BR:vir04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   X953_13845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin DUF935 FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AIF44111
UniProt: A0A075JQ68
Position
complement(2568298..2569476)
Genome map
AA seq 392 aa AA seqDB search
MKDVYILEGARTPFGTFGGMFKDVDPTELAVAASAEAFKRSNVNPEEVDLTVMGNVIHST
KNAPYLTRHVALKSGIPVDKPALTVNRLCGSGLQSVVSAAQSLMLGEGNIALAGGVENMS
LAPYALRGSRFGTKLSAPQVDDMLWASLTDEYIGAGMGVTAENLADKYKISREEQDEYAA
LSHQRAAKARDDGKFMEEIVPVEITSRKGKTEHNTDEHIRDDTTTEKLAKLKSAFKKAGT
VTGGNASGINDGAGALIIATGDYVSTTKRKPLARIISWGIAGVEPSIMGIGPVPAIQQAL
KRANLTLEDMDLIEVNEAFASQYLAVEKELELDRSIVNVNGGAIALGHPIGASGTRVVYS
LCKELKRRGLTYGVASLCIGGGQGIAMVVEVN
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatgtatatattttagaaggtgcacgaactccctttggaacatttggtgggatg
tttaaggatgtagatccaacagaattggctgtagcagcaagcgcagaagcatttaaaaga
agtaatgttaatccagaggaagtagatttaaccgtaatgggtaatgtcattcattcaacc
aaaaatgcgccgtatttaactaggcatgtagccttaaaaagtggtatacccgtagataaa
cctgcattaacggtaaatcggttatgtggttcaggactacaatctgttgtgtcagcagca
caatcactaatgctcggggaaggcaacatagcattagctggcggggtggaaaatatgagt
ctagcaccatatgcgctcagaggaagtagatttggcacaaagctaagtgctccgcaagtt
gatgatatgctttgggcttctctaacagatgagtatattggggcaggcatgggggttact
gctgagaatcttgctgacaagtacaagattagcagagaagaacaggatgagtatgcagct
ctaagtcatcaacgagcagcaaaggcgcgtgatgatgggaagtttatggaggaaattgta
ccagttgaaataacttcaagaaaaggaaagacagagcataatacggatgaacatattcgt
gacgatactacaacagagaaactcgccaagctgaaatctgcattcaagaaagcaggaacg
gttacaggggggaatgccagtggaattaatgatggggcaggagcgcttattatagctact
ggcgattacgtatccacaacaaaacgtaaacctttggctagaattatttcctggggaata
gcgggggttgagccatctattatggggatagggccagttccagcaatacaacaagcgttg
aaaagagcaaacttgactttagaagacatggatcttattgaggtaaatgaggcatttgct
tctcaatatcttgcagtggaaaaagagttagagctagaccgaagtatagtaaatgtcaac
ggaggagctattgccttgggacatccgattggtgcaagtggtacaagagtggtgtattcg
ctatgtaaggaacttaaaagacgaggtttaacatatggagtagcatccctatgtattgga
ggcggtcaaggaatagcaatggtagttgaagtaaattaa

DBGET integrated database retrieval system