KEGG   Virgibacillus sp. SK37: X953_14920Help
Entry
X953_14920        CDS       T03219                                 

Definition
(GenBank) thiaminase
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
vir  Virgibacillus sp. SK37
Pathway
vir00730  Thiamine metabolism
vir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vir00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    X953_14920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vir03000]
    X953_14920
Enzymes [BR:vir01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     X953_14920
Transcription factors [BR:vir03000]
 Prokaryotic Type
  Other transcription factors
   Others
    X953_14920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AIF44302
UniProt: A0A075JS33
Position
2798126..2798824
Genome map
AA seq 232 aa AA seqDB search
MQFTDTLREATKNSWEQSVNHPFVKGIVNGDLPLETFKYYILQDIYYLKHFGKVHAMAAA
QAEDFHVTAMLAEKAKSTAQAELTVHKAHAEILNISEEDTANFKPAPTAYGYTAHLYRAA
HSGSLGQTVAALLPCYWLYADIGKTYKDAKPKEKIYQNWINTYADDWFHTSTQEQIDLLN
SIAEDSSEHEKEKMKEQFIIAKEYELAFWEMAYTKEQWFSDRQWHAPVSLNK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttaccgacacactacgggaagcaacaaagaatagctgggagcaaagtgtaaat
catccatttgtaaaaggtattgtgaatggtgacttaccgcttgaaacattcaagtactac
attcttcaggatatctattacctgaagcattttggaaaagtgcatgcaatggcagctgcc
caggctgaggattttcatgtaaccgcgatgcttgctgaaaaagcaaaaagtacggcacaa
gcagaactcactgttcataaggctcatgcagagatcctaaatattagtgaggaggataca
gcgaatttcaaacctgctcctacagcttatggatataccgcgcacttatacagagcagca
cattcaggcagccttggacaaaccgtagccgcactcttaccttgctattggttatatgcg
gatattgggaaaacatataaggacgccaaaccaaaagagaagatatatcaaaattggatt
aacacatatgccgacgattggttccacacctctacgcaagagcaaattgatctgttgaat
tctatagcggaagactccagtgagcatgaaaaggagaagatgaaagaacaatttattatt
gctaaggagtacgagcttgctttctgggaaatggcatataccaaggaacagtggttttct
gatagacaatggcatgcacctgtttctctaaataaataa

DBGET integrated database retrieval system