KEGG   Vitreoscilla sp. C1: ADP71_03810Help
Entry
ADP71_03810       CDS       T05336                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
vit  Vitreoscilla sp. C1
Pathway
vit00010  Glycolysis / Gluconeogenesis
vit00053  Ascorbate and aldarate metabolism
vit00071  Fatty acid degradation
vit00280  Valine, leucine and isoleucine degradation
vit00310  Lysine degradation
vit00330  Arginine and proline metabolism
vit00340  Histidine metabolism
vit00380  Tryptophan metabolism
vit00410  beta-Alanine metabolism
vit00561  Glycerolipid metabolism
vit00620  Pyruvate metabolism
vit00625  Chloroalkane and chloroalkene degradation
vit01100  Metabolic pathways
vit01110  Biosynthesis of secondary metabolites
vit01120  Microbial metabolism in diverse environments
vit01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ADP71_03810
   00053 Ascorbate and aldarate metabolism
    ADP71_03810
   00620 Pyruvate metabolism
    ADP71_03810
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ADP71_03810
   00561 Glycerolipid metabolism
    ADP71_03810
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ADP71_03810
   00310 Lysine degradation
    ADP71_03810
   00330 Arginine and proline metabolism
    ADP71_03810
   00340 Histidine metabolism
    ADP71_03810
   00380 Tryptophan metabolism
    ADP71_03810
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ADP71_03810
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ADP71_03810
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ADP71_03810
Enzymes [BR:vit01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     ADP71_03810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AUZ04183
UniProt: A0A2L0PJ26
Position
309485..309715
Genome map
AA seq 76 aa AA seqDB search
MTQLKDYRQFYINGQWVNPAVARDLEVIDPSTEQAVAVISLGDQVDTDAAVAAAKAAFPA
WAATAPETRLAYVEKS
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgacacaattaaaagattaccgtcagttttatatcaatggtcagtgggtgaatcctgct
gtggctcgtgacttggaagtcattgatccttcaaccgaacaggctgtggcggtgatttct
ttgggcgatcaagtagatacggatgccgctgttgccgctgcgaaagccgcatttccagca
tgggctgccactgcgccagaaacccgtttggcttatgtggaaaaatcttag

DBGET integrated database retrieval system