KEGG   Vitreoscilla sp. C1: ADP71_08500Help
Entry
ADP71_08500       CDS       T05336                                 

Definition
(GenBank) subunit A of aspartyl/glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
vit  Vitreoscilla sp. C1
Pathway
vit00970  Aminoacyl-tRNA biosynthesis
vit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vit00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ADP71_08500
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:vit03029]
    ADP71_08500
Enzymes [BR:vit01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ADP71_08500
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ADP71_08500
Mitochondrial biogenesis [BR:vit03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ADP71_08500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AUZ04591
UniProt: A0A2L0PKC7
Position
701820..703268
Genome map
AA seq 482 aa AA seqDB search
MKPLSVKQCSDLLQSKQISATELAQDYLNQIQEHNPAINAYIHLDADRTLAQAQKADERL
QSGTDSLLTGVPIAVKANFCEEGWTTSCGSKMLENFIAPYTAHVVQNVRNHGMVSLGKVN
MDEFAMGSTSESSFFGITRNPWNLNHVPGGSSGGSAAAVAARLAPAALGSDTGGSIRQPA
AHCGVTGIKPTYGIISRFGMVAYASSLDQAGPMAQTAEDCALLLNAMAGFDERDSTSLER
AKEDYMRDLNLPLTGLRVGLPKEYLEGGLNADVAATVQNTVDLLKSLGAQMVDISLRQTE
FVIPAYYVIATAEASTNLSRFDGVRYGHRTDSFESLDEFYSKNRAEGFGEEVKRRIMMGT
YVLSHGYYDAYYVKAQQLRRLVSNDFQAAFEQCDVILAPASPTAAPAIGSQTKDPVQMYL
SDVFTTSLNLAGLPGISVPAGFSQDGLPIGMQLFGNYFAEAKLLNVAHQIQLNSDYHTRT
PA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccattaagcgtgaagcaatgcagcgatttgttgcaaagcaaacaaatttcagcc
actgagttggcacaagattacttaaatcaaattcaagaacacaatccagcaatcaatgct
tacattcatttggatgcagacagaactttagcgcaagcgcaaaaagcagatgagcgtttg
caaagtggcaccgacagtttgctcacaggtgtgcctattgcggtcaaggccaatttctgt
gaagaaggttggacgacgtcttgtggttcgaagatgttagagaactttatcgccccttat
accgcacacgtagtacaaaacgtgcgcaaccatggcatggtcagcttgggtaaagtgaac
atggatgagtttgccatgggttctaccagtgagtcatctttctttggcatcacacgcaat
ccgtggaatttaaatcacgttccgggcggctcaagtggaggctctgctgcggctgtggcg
gctcgtttggcacctgcggctttgggttcagatacaggcggctctattcgtcaacctgcg
gcgcattgcggtgtgacaggtatcaaacccacttatggcattatcagccgttttggtatg
gtcgcttatgcttcgagtttggatcaagccggtccgatggcacaaacggcagaagattgc
gctttgctgttgaatgcgatggcaggctttgatgaacgtgactcgaccagtttggagcgt
gccaaagaagattatatgcgcgatttgaacttgccattgaccggtttgcgcgtgggtttg
ccaaaagagtatttagaaggcggcctgaatgcagatgtggcggcaaccgtgcaaaatacc
gttgatttgctcaaatctttgggtgcacaaatggtagacatcagcttgcgtcaaaccgaa
tttgtgattcctgcgtattatgtgattgcgacagccgaagcgtcgaccaatttgtcacgt
tttgatggcgtgcgttatggtcatcgcactgatagttttgagtctttggatgagttttac
agcaaaaaccgcgctgaaggttttggcgaagaagtgaaacgtcgcatcatgatgggtact
tatgtattgtcacatggttattacgatgcctattacgttaaagcacaacaattgcgtcgc
ttggtgtcgaatgactttcaggccgcttttgagcaatgcgatgtgattttggcgccagct
tcaccaacggcagcccctgccattggcagtcaaaccaaagaccccgtacaaatgtatttg
agtgatgtgtttacgacatcgttgaatttggcgggtttgccgggcatcagcgtaccagca
ggcttcagtcaagacggtttgccaattggcatgcaattgtttggcaattattttgcggaa
gccaaattgttaaacgtggcacatcaaatccaattgaacagtgactaccacacacgcaca
cctgcgtaa

DBGET integrated database retrieval system