KEGG   Vitreoscilla sp. C1: ADP71_09800Help
Entry
ADP71_09800       CDS       T05336                                 

Definition
(GenBank) decarboxylase UbiX/Pad1
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
vit  Vitreoscilla sp. C1
Pathway
vit00130  Ubiquinone and other terpenoid-quinone biosynthesis
vit00627  Aminobenzoate degradation
vit01100  Metabolic pathways
vit01110  Biosynthesis of secondary metabolites
vit01120  Microbial metabolism in diverse environments
vit01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vit00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    ADP71_09800
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ADP71_09800
Enzymes [BR:vit01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     ADP71_09800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein PucR
Motif
Other DBs
NCBI-ProteinID: AUZ04691
UniProt: A0A2L0PKN4
Position
805276..805896
Genome map
AA seq 206 aa AA seqDB search
MMLSTPIQTVTLGLTGASGMPYGIRLLECLLRYGKTVWLVYSQAAQIVAQQEMGLQLPSS
PSACEKMLHERYGVDASRLRVFGQNQWSAPPASGTHVADAMVVCPATMGMVAAIAYGTSD
HLLERAADVCIKEGRPLIIVPREAPFSALHLENLLKLARLGVCVLPPSPGFYQHPKTIED
IIDFVVARILDQLRIEHDLLPRWGEE
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatgctctctaccccgattcaaactgtcactttgggtttaactggcgcttccggcatg
ccatatggcattcgtttattagaatgtttgctgcgttatggtaaaactgtgtggttggtg
tattcgcaagctgcacaaattgtggcacaacaagaaatgggtttgcaattgccatcatca
ccgtctgcatgtgaaaaaatgttgcatgagcgctatggtgtggatgcgtctcgtttgcgg
gtgttcggtcaaaatcaatggtcagcgccacctgcttcgggtacgcatgttgccgatgcg
atggtggtatgtcctgctacgatggggatggtcgcagccatcgcttatggcacttcagac
cacttgcttgagcgcgcggctgatgtgtgcattaaagagggacgtccgttgatcattgtg
ccgcgagaagccccattttcggcgctacatttggaaaatctattgaaattggctcgtttg
ggcgtctgtgtgttgccgccatctcccggtttctaccagcacccgaaaaccattgaagac
attattgactttgtggtggctcgtattttggatcaattgcgcattgagcatgatttgctg
ccacgttggggtgaggaataa

DBGET integrated database retrieval system