KEGG   Vitreoscilla sp. C1: ADP71_10000Help
Entry
ADP71_10000       CDS       T05336                                 

Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
vit  Vitreoscilla sp. C1
Pathway
vit00020  Citrate cycle (TCA cycle)
vit00620  Pyruvate metabolism
vit00650  Butanoate metabolism
vit01100  Metabolic pathways
vit01110  Biosynthesis of secondary metabolites
vit01120  Microbial metabolism in diverse environments
vit01130  Biosynthesis of antibiotics
vit01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ADP71_10000
   00620 Pyruvate metabolism
    ADP71_10000
   00650 Butanoate metabolism
    ADP71_10000
Enzymes [BR:vit01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     ADP71_10000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans Oxidored-like
Motif
Other DBs
NCBI-ProteinID: AUZ04709
UniProt: A0A2L0PKJ0
Position
822734..824239
Genome map
AA seq 501 aa AA seqDB search
MTQERIKVASLLDKVMSAAEAAQLFEDGMVVGSSGFTKAGDSKEVLPAFADRVAAGEKVQ
ITLLTGASLGHGTDGKLAAAGALKKRMPFQVDATLRGKINQGEILYLDQHLSEAAELLHN
GFMKLDLAVLEVAGIEKDGSLIPTTSVGNSASFAALADKVILEVNESVPLDVLGIHDIYM
AESYPYRNVIPVVAADNKIGRRTIPLDISKVVAIVRTSKHDSPADIAAPDAKTTAIAGHI
LKFLEAEVEAERLTERLLPLQAGIGKVANAVLTGFKDSNFKHLTMFSEVLQDSTFDLIDA
GVMDFASASSITVSAECYDRVMNNLDAYRDKMVLRPQNISNTPGLIRRLGVIAINTAIEF
DIYGNVNSTHISGSRLMNGIGGSGDFARNAYLSIFVTQAASKENKISHVLPMVSHVDHTE
HDVDILVTDVGLADLRGLAPRERAIEIINNCVHEDYREELKTYFERACAEVGGQTPHLLG
EAFAWHIRLAETGSMKKTVTA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagaacgcattaaagtagcatctttattagacaaagtgatgagcgcagcagaa
gcggcacagttgtttgaagacggcatggtagtcggttctagtggttttaccaaagcaggc
gacagtaaagaagttttgcctgcatttgcagatcgtgtcgcagctggtgaaaaagttcaa
atcaccttgttaacaggtgcttctttgggtcatggtaccgatggtaaattggcagcagcg
ggtgctttgaaaaaacgcatgcctttccaagtagatgccactttgcgcggcaaaatcaac
caaggtgagattttgtacttggatcaacatttgtctgaagcagccgaattgttgcacaac
ggtttcatgaaattagacttggctgttttggaagtcgctggtattgaaaaagatggcagc
ttgattccaaccacttctgtgggtaacagtgccagcttcgcagctttggctgacaaagtg
attttggaagtgaacgaatcggtaccattagatgttttgggtattcacgacatttatatg
gctgaaagctacccataccgcaacgtgattcctgtggtcgctgcggacaacaaaattggt
cgccgcaccattcctttggacatcagtaaagttgtggcgattgtgcgcacgagcaaacat
gacagtccagcggacatcgctgcacctgatgcaaaaaccactgccattgctggccacatc
ttgaaattcttggaagcggaagtggaagcggaacgcttgaccgagcgtttgttgccgttg
caagcgggtattggtaaagttgccaatgcagtcttgactggctttaaagactctaacttc
aaacacttgacgatgttctctgaagtattgcaagactccacttttgatttgattgatgcc
ggtgtgatggattttgcttctgcgtcttcaatcaccgtttctgctgaatgttacgaccgt
gtgatgaataatttggatgcttaccgtgacaaaatggtgttgcgtccacaaaacatttct
aacacaccaggtttgattcgtcgtttgggcgtgattgccatcaacacagcgattgagttt
gacatttacggtaacgtgaactcaacccacatcagcggtagccgtttgatgaatggtatt
ggcggttcaggtgactttgcgcgcaatgcttacttgtcgatttttgtgacgcaagcggca
tctaaagaaaacaaaatctcgcatgtgttgccaatggtttctcacgttgaccacaccgag
cacgacgtggacatcttggtgactgatgttggtttggcagatttgcgcggcttggcgcca
cgtgaacgcgcgattgaaatcatcaacaactgtgtacacgaagactaccgtgaagagttg
aaaacttactttgagcgcgcttgtgctgaagtaggcggtcaaacaccacatttgttgggc
gaagcattcgcttggcacattcgtttggcagaaaccggctctatgaaaaaaacggtgact
gcataa

DBGET integrated database retrieval system