KEGG   Vitreoscilla sp. C1: ADP71_21710Help
Entry
ADP71_21710       CDS       T05336                                 

Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
vit  Vitreoscilla sp. C1
Pathway
vit00360  Phenylalanine metabolism
vit00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vit00790  Folate biosynthesis
vit01100  Metabolic pathways
vit01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vit00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    ADP71_21710
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ADP71_21710
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ADP71_21710
Enzymes [BR:vit01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     ADP71_21710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H PNKP-ligase_C
Motif
Other DBs
NCBI-ProteinID: AUZ05583
UniProt: A0A2L0PN18
Position
complement(1670929..1671717)
Genome map
AA seq 262 aa AA seqDB search
METQHVYTAKQSDAHGHIAWTEVEDETWQRLLTRQLSHLQDKACDEYLLGLERLDLPQDH
IPNLQDISRVLYQATGWQCAEVPALISFDRFFKLLSERKFPVATFIRRPEDMDYLQEPDI
FHEIFGHCAMLTHPAFADFTAQYGKLGMAASKQERAYLARLYWFTVEFGLLETSQGRKIY
GGGILSSPQETDYAFASQVPERRMFHLSDVLRTRYRIDVLQPIYYHLTDVNDLYDLAHID
IMSEVRKAQALGLFPLPEAISH
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgcaacacgtttacactgccaaacaaagcgatgcacatggtcatattgcatgg
actgaggtggaagatgagacttggcaacgtttattgacacgtcaattgagccatttacaa
gacaaagcttgtgatgaatatttgttgggtttggaacgcttagatttgccacaagaccat
attcccaatttgcaagacattagtcgtgttttgtaccaagcgacaggttggcaatgtgcg
gaagtgcctgctttaatcagttttgaccgcttttttaaattgttgtctgagcgcaaattt
ccagtagcgacctttattcgccgtcctgaagacatggattatttgcaagagcctgatatt
tttcatgaaatttttgggcattgtgccatgttgacccatcctgcgtttgcagattttacc
gcacaatatggtaagttaggcatggcagcgagcaagcaagagcgggcatatttggcgcgt
ttgtattggtttactgtggaattcggtttgctcgaaacctcacaaggccgcaagatttat
ggtggtggtattttgtcttcgccgcaagaaaccgattatgcttttgcctctcaagtgcct
gagcgccgcatgttccatttgtccgatgtattgcgcacccgttatcgcattgatgtattg
caaccgatttattaccatttaactgacgtcaacgatttgtatgatttggctcatatcgac
atcatgagcgaagtgcgcaaagcccaagctttgggcttgtttcctttgcctgaagccatc
agccattaa

DBGET integrated database retrieval system